SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09176T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_09176T0
Domain Number - Region: 236-274
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00442
Family TNF receptor-like 0.0058
Further Details:      
 
Domain Number - Region: 195-222
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0377
Family TNF receptor-like 0.0075
Further Details:      
 
Domain Number - Region: 11-51
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0841
Family TNF receptor-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09176T0
Sequence length 390
Comment | PTSG_09176 | Salpingoeca rosetta predicted protein (391 aa)
Sequence
MGAVCLPSPVAATCSSACPPGQGCGASGEIGTSCVDCDPGFWSSSTDTTACTVCADCTFL
PNHFEEEACTTTSDTVCTECRTCTSEEYKTADCTDTTDTQCEACIQCDFGEVESRACGGS
DGTQNRECRACSGNEYHAHPTDTACSFCSQCTADQYEAATCTPTSDRQCFNITTCTDAQY
ETVAPTATSDRNCTDCTDTCPQGQYIGVPCSASVDAACTPCTTVDACGADEFLDGSCGGH
SNTVCRMCTTSCPPDHYIAANCTSYNDTMCLPCLRDDDCPDGQVALGSCSLHSNTFCAPT
PPPSPVPISTDATPSDDAINYITKQNPSALLRLKSALQPCTTCQSAPMTAFGNAPLILDV
DGVATGVDDDDDLRACDDASAIAAISGSLY
Download sequence
Identical sequences F2UMY2
PTSG_09176T0 XP_004989430.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]