SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09308T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09308T0
Domain Number 1 Region: 48-120
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000457
Family SH2 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09308T0
Sequence length 155
Comment | PTSG_09308 | Salpingoeca rosetta predicted protein (156 aa)
Sequence
MASHKRFSFQGPAVTLGAAAATSRLHPAAAATQPQQRQFSRPQHQLAQTDGEFELRPHSD
GRWFALNISYGSGTITRIIEKSPEGFMVLGSQSKRAFPTLAALIEHYMVPSVDLPCPLRR
RARKSTHPQASAVTSTLASHLAHSPQRSARRVVQH
Download sequence
Identical sequences F2UM93
XP_004989565.1.12839 PTSG_09308T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]