SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09339T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09339T0
Domain Number 1 Region: 608-744,819-952
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.59e-31
Family Galactosyltransferase LgtC 0.063
Further Details:      
 
Weak hits

Sequence:  PTSG_09339T0
Domain Number - Region: 957-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000948
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Domain Number - Region: 417-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09339T0
Sequence length 991
Comment | PTSG_09339 | Salpingoeca rosetta conserved hypothetical protein (992 aa)
Sequence
MAVSQSIRDRDRDRTSVCGVVAAGVALLLLIVVAYLVLAFRSHGRALSSSTSALATRGAS
EHGSLIVAGDLERGAADVALALLEQERAHSLKGRGRRRRTVAVIAQYPLQAGISSREKLE
AKARQLHEAGIPLLIMDLCNHHERSRALNTVKSGTWVGIGLTARECECMAQHADTLLSSE
MHHVLLVDRATVTQRLSLIVHGGASGVHVVAPHDVATALVYGRELARAGCVLDRAALQQV
VTGGVGDDAPSWCAQPHTWTKLLSLLRQEEHDGGDAGTQYPPKTTTHTDTTPWATAWAAH
VARYHSIADAWAQEQESQRHAARCMVSGMMTAWELPPFRSPPTKAFMFFSGVDSPGHEVM
IYASGTLDEWEQLCNELSECVAFNTRGELKKRVRPRDDWKRFEAAESIKDGLYVAANIDV
CDLDLHHCHKDAVCNPQDLASYTCTCNKGLDRPKFPEVDAPFVFFPHMDSNLHDLLLVER
TIQEDGDAHVRRLMDTCRSLPRCLGFNTNGMLKERIARPDEWYAFTEDDNAGLYVLDIDY
CTLSDEGCVVGASCQKKGPGLYQCECDDDSLELTEVSAGEDTAMDAREPRTVQQQQQQQQ
VLSKPRAITIVLTADSEHYAGIVAVINSARRHSAVPGRLIFHVLAVADAYALAVYLRCRG
LQAEVQQQQQQQQQQQVEDVALLWNSIRALALVRTSRGIAGNLASDANFARFLIPPLFAS
ETAVLYLDADTLVQGDLANLWAIVQAASTVPTAAADGGGGGGGGGGGGAAAAAAAAAATD
HAAADVDAGAGVSNIDSRTAHQAAPVVAAVPRAFPTYASFFNAHVRDLYKQHYGDGAAMM
VDEPTFNAGVMVFWPHRWQQQRVDEDVLWWMQQHREHVNDADNGLWDFGTQPLLLLAVHN
RWMHLPAEWNVNGLGYRTDIKQDVIDGASVLHWSGRQKPWLEDVGLYRSIWLPFSRVPCS
GHGTCSLDDNGCRCEHNWVGEHCQTSARGSH
Download sequence
Identical sequences PTSG_09339T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]