SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09357T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09357T0
Domain Number 1 Region: 26-364
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.29e-31
Family beta-glycanases 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_09357T0
Sequence length 529
Comment | PTSG_09357 | Salpingoeca rosetta predicted protein (530 aa)
Sequence
MMIWAVVAVVLLATSPCVAAEEVSEFVVRDGSQLKLKGKPWVYSGCNMYWLGLDSNCEAG
LNESCIHYPSFYRIDDAIETAQGLGFSVIRAHTLGISSGSQSNGLALHPNRTTYNDKAFA
TIDYAIYKAKLAGIRLVVPFTDNWDYFHGAYRNFVDWRGYTCKTTQVPSPGSDCIRFYND
QQVVDDFHDYVAHILNHVNNFTGVALKHEPAILAWETGNELAEKGPIFSNWTNDLGRFIK
VDLGAKQLVMDGRQEWSYGMEADALASPYIDMYTDHYYMDWASAIKLMRKDGAAVHAANK
VFVVGEYGPGKYTVDQVQSFLHAVETDTDTQGAPLVSGDTWWSFFGHGSVYGFVNHSDGF
TIHYPGEDAQHHAMINALREHAYRKRGVPLPSKLPVPGTPSITLAEASAPSRGANACKHV
KLTWRGAAMACNYTIQRSPQLTPTPAWTTICNACATDLSPPWWDNTTCIAADAADAAAGA
AGAGGGGSHLPFYRLAGVSCDGQQGPYSSPVQATTTTATTTTATAVGAA
Download sequence
Identical sequences F2UME2
PTSG_09357T0 XP_004989614.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]