SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09371T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09371T0
Domain Number 1 Region: 251-326
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000893
Family Proprotein convertase P-domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09371T0
Sequence length 364
Comment | PTSG_09371 | Salpingoeca rosetta predicted protein (365 aa)
Sequence
MAQTFRALTALVVAVVALVSVPVSATTITTGCESTQYDGSAQLTFRCIRSKKIAEYEDWR
LNKFARKLNEQLTASCGLSQCDVRSTNASDIEVVADGTNAVRVAVHNASTVEAIETCMST
TKVRFMQCNLKLVNYVAEGNTDVCQDTTYSTSAVLTTKCLRNQKLDEFTDAQLDKFASQL
RDAIQEDCGLDTCDLSLKDGSSVTPLAPNKFSVAAKDATVVAALGACKLRFHRCKVNVVV
ESADLCHEETVDIPNFVATSHIQSICIDLKHTFISDIDLYLRCPSGQKLELATDLGGSAD
VDGQHCWTPSATSLFPANPAKPEGDWSALDGCTTSGTWVFEYADDFAPEDDATIRAVDVT
LLNP
Download sequence
Identical sequences PTSG_09371T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]