SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09446T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09446T0
Domain Number 1 Region: 493-608
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.64e-36
Family MBT repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 1107-1171
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 7.59e-21
Family Mib/herc2 domain 0.00011
Further Details:      
 
Domain Number 3 Region: 26-100,146-236,326-475
Classification Level Classification E-value
Superfamily ARM repeat 7.09e-16
Family Armadillo repeat 0.051
Further Details:      
 
Domain Number 4 Region: 964-1074
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000526
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_09446T0
Domain Number - Region: 260-298
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0104
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09446T0
Sequence length 1470
Comment | PTSG_09446 | Salpingoeca rosetta hypothetical protein (1471 aa)
Sequence
MDVDPDALLDFLSVPGDAQMTALEQLCMLLLLSDNVDRVFRQFPPSSFVPALCKILVSDT
ATPTVLEATLRALSFFLDISMDCVGRITSCDGAISAICRHLEAADLTDAITKDMAMQSTK
VLEMISNRDTAALYRAGALRSCLHFVVEGQSLVFLDALKSAMNVVVRCCSRIDEKDDYLP
QVIEHLNTLLDSEQPDLRNTALQCYGTLTDKLSRQKGDLGALATEGTVRSLLRLICSTAS
TASDAELEIARIALNTLNALWYGADTSRHDEDGRTALELAQAGEHQACADILSSPEQHME
EAEDEEDEGEEEDDGGDGDADAAESDASSPTRAAVMGTHSIMGDGTPDIKDEAARTSDAP
NPLLDLSMMCAEQVVPPLATALTNLSSIQTQGMLLRVIARFTAHLSQEDLSNFIQYGHNF
SLEMILDPLPEILESDDGQAMLAAVTIVKHLVEKNVPSARNDILRLGLVARLATLAERAE
ALAKETKPQESEETIEPGMKLEAVDRKNPGLVCVATILEIDNSRPDCLHIRFDGWTDRYD
YWADPTSTDLRPVGWCEHNSHTLQIPRGYSKRFDWQQYLRETNAKAAPAHLLATVHVHGG
QAKKLREALTKAKALYDKHFGANAVERDVVRRLREISTMLVTLVRSTPNACVTPTTHASL
DFAVDERQGASTAKNNSNATAGTPTGSGSSSNNPHPETEDVPIVGLQRQLSSGSQLALQR
KQDMVHCLVKLSELLVSDKSISSYELCRSKFDESLLMFLTHVTRRASVSRADGHTDLEMR
RVLFRQVFGVQPSKTDNPAALLVRKLLSVVEHTEALPVFQFSKTTKDTLEVMNRALTLEV
QRHPNSRELKCLDGNTLRVEPLTTVQQLLDFLKPRTKKKWYDYQRQKLSFFKRIRDGEKV
TCKYESDFDQNGVVYWIGTNGRRESSWVNPSETHLIYITTHIGRELPFGRVRDIVSRDSS
PRNCHTNNNKSGWVSIDLGLLIKPSHYTLRHATGYSSSALRTWSLEGSDNGKEWFTLREH
EKDEHLRSPGDTHTWEITTAPPRPVCMFRIKQKGPDSDGKNHYISISGFEVYGEIVGVSK
RSFDKALRQEVLQRQRQLEKLRRSADVIQPGVRVKRGRDWKWGDQDGNPPGPGTVTSTVK
QGWVDVEWDDGGVNSYRMGNDGKYDLELISDEERQMDEEEDTAERTAASKKKKKKREEAP
AKAGEAMDVNSDDVDDDDHDGDDDDDDGDDDKDGGNATSTGTVATAGSSEAERVRASLRA
VAGDILTSDEDESDDDDDDDDDDDDDDDDDEVEEEDNMFTSSQSRAMFDLEHYLGRDELY
HRRGPVAAFLRRRRHREASVSSSTWDSSTTLKRQYSALVPAYDPRPGHSNPPATVDLHVP
GPDTHVSLPTPQQNKQQDPFVLYLMKDPEKGLQADNLAKLDPSCTILRQIQRHCFDANNW
KPTDVWGKRFKIVYSNNKPTPKRKVRVISE
Download sequence
Identical sequences PTSG_09446T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]