SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09465T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09465T0
Domain Number 1 Region: 258-417,541-679
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.48e-19
Family YicI catalytic domain-like 0.0099
Further Details:      
 
Domain Number 2 Region: 684-768
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000137
Family Putative glucosidase YicI, domain 3 0.002
Further Details:      
 
Domain Number 3 Region: 23-247
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000138
Family YicI N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09465T0
Sequence length 913
Comment | PTSG_09465 | Salpingoeca rosetta predicted protein (914 aa)
Sequence
MTGRLALQGVLRQRLLTLLAMVAVVAGGHAVCADATIVFPTQDGIVVPLDEHNVELAAVK
PGWLRLSVFSSNARDGGRVPTPMVSVGHNDTPAFSWWQDDGYVIFRTADGRLVLAENGTT
WALQGPDNTTIMLSKKLLSKPSPSSSDLLLHVNRSSDAHVYGCGRLTNTTKVLPLNCSRG
LPLVSEFGFLSSFAWSTDGFAMFGVVPDNDARSQPFLNLSWAQATEEFLWQFSAHHPRLD
LYLAPAPTLRDAVVLLWNLTGAPGLLPSYSLSFLASRSGWEEPPSISKAVDEFSSGHFPL
SAVVADYEWFSPESDAQLPPEGAANFSDFGLNPAVLPGGPKFLQQLRSQGVHFGGVRWPR
LGNTALLREAGSLGCLFHEPPRHLRFNDKACREWYTRQLQADTQAGVSFFWNTGGDSAYY
TYMYWARAQTNAFKDHIPPTTTTTTTTTTTTTTSTTTTTTSTTTTSTTTTSTTTTTTSTT
TTTTTRRTSTTSTTSTTSTSSSSSSTTVRLHPQFHNKTAQAESPIVQWRALRTRAGEGQP
EPSSASCNGTHRRPFSLSNAFTPGIQSLGNVATTGRIGSSWDDLEAAAGDIVAYLMAGTA
FVSVDIGGNSQGTVPDTLLVRWYQLGLFTTVPRSSSARTSSPHFPFDAQTPPAVDAIRAA
MRLRQRLMPTIYAAMVWQHVLLEPMLRPLLFEFPNDAEAAQTATQWLLGSGLMVAPVLSS
SDQVQVYLPVGLWFPFTQTPTSSPTQGIAGPTHHDVVAELADIPLMVRAGTLLALQDVGS
SPSPPGLLTIYVYAGRNASIAVVEDDGKHYCGSGRVTTFSWNDDTLVLSWTRTAASSGGG
GGGGGRVGDGDVTGEAEANSVLFPAASPGYIVVQAVLWQNGTAPIQSHARNIGLSGFLDF
ATLMSPNSHKRTL
Download sequence
Identical sequences PTSG_09465T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]