SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09546T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09546T0
Domain Number 1 Region: 1862-2114
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000719
Family Tropomyosin 0.00082
Further Details:      
 
Domain Number 2 Region: 572-813
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.0031
Further Details:      
 
Weak hits

Sequence:  PTSG_09546T0
Domain Number - Region: 2092-2258
Classification Level Classification E-value
Superfamily Tropomyosin 0.000242
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09546T0
Sequence length 2785
Comment | PTSG_09546 | Salpingoeca rosetta predicted protein (2786 aa)
Sequence
MSWRQNEWKNNLPGVALQKVEELERRVQQLTRDTQNKTFQIDNLNAAQVKIKNQAAESKR
RVQELEREACSLGQTIDQLHRQNSRLQDDVKARTMQINQLENKIAQHTKEAQRDKATIKD
LHAENARLQDQAAAASKAQEHSTYQQVSTLKQQLLEAENKIKSTETHYKKLLEEAHDAAQ
RVQDELDAARANIEELQTGMKQRETIVETMQQQLSTQQQTSSQSLEEADAHAHKLLAKAT
KEAEARNLEIEKQQTAQRDQLEATIADLRAQLNAARQDSQSTESEHTMAASSLAQQLADS
KKELEQLQAKYAQAQVGLENAEAKAAAHDKAFKQAQSRVTDLENELSGMFNEQTMSKDKI
TELEAQVKSFKQNLAARDTAYKHLRQTKLKLESTLKEQAETQEKTMADMQQLLQSAQQEL
KQEQEDHTAAKQVIDAHKKELASLRTQLQEQQQAVVAAASQERVKELEEQLEHAHAVTKK
LEVQTLNAAVTHKSIKEEVVGLRKQVPQLQQELDQAQEALKTKTEEHATALAELQKAKDD
CESLNTALASARSKVDEMTNETAAASAASNTAIAQLEEQVHVLQKEKDDLQAQFDNARAT
HDQLTKERDDAQQALQEAQDAATTAAKQAAELQTRVQELEAAAPDMDAINQQMEQHRATL
AEREAEWTTARTQIEASLAKAQQECSAQQQRVQQLEAQLDEECRKHEAAQTQLHHAVAEA
EAQLSAAQATNSKQARELDNANALVEKYKAEQHALRLASDNLERSMRKLRRDLDSHAASA
KDELAQTSSSLSAAFTKLEHLAAENKTLREKLHNAEEATATRTRTRTRAAAQLKDELAQA
QADMESLQEQLQTKKDECTELTARLKEADDLAAQLRTELTAIKNNASSNDAAQRDLAAKL
EQVQAQAAAQTQRATQLEEKRAELVRAVASLEGKLAQVTSDSREEVHALKKELDHIAQER
ESLVRSLESAQEEQSTATHDALAAKERVKELEELCASLKEQVHAEQARVTEAKAEANAQA
AQQLQGEMQELMAKVVSLQDERTELQQAKVALEEKLAALTQEMAAQEKSTKELKRNLRTT
RMNLEAQLECAQEDAESLCEESEAKDEQLYAVKKELENTQVALKAAEQTQQRLEEAEQQL
RAELAAGEEKQDALRDQINALKAENDKLQSNLAFDDAVVHSKGDEVSTIKTRLEEALAEL
DAVKTQHSTEREAMQRDQETTAHELQQAQQACEELTTQASQEKAAAEAAHVELEKAKAKA
QENAGQAASLEAELAQLRESSKLELDRAQQQCSELEDRVAFLQSQDARRTQLLEQVEQQE
KELQELKAAKNEVDAQCAELQQAQQATAASLETAEQRQRELEEQLEAARCERQEAKRALD
TARDKIARLEKEAEAATSEGEQQRQQHEEARNAQLQQLQCFLDMKEEELVVLRAEVDSLK
TAVRQANDDVSKLKGECAEKAAALTAAEEQRQEMVSQHQRLQQQQAEEHQLALESKTQEL
ANMDDNMNKLQAQLDAKEEEKLAAEAKIEQLSKDIDQLQTSSAESAGALNSAREALATAE
AQLAQNSMEREALEEELRVLKESAERDTQETAAELAQATSAAKEATAALATAQEELTQLR
EQLQAQADEAEAKQAKLAAESKVEIERLEKEVADKSQAAQAAAEARDEASAQGEALQQKL
GDLQEQVSALEESRQRLEAELVSAKEDADESQRAARAEHQQQLYEVNAKHAQEVDEAEAA
AQAELNDVRLQHETAISAMNEQVEALASEVTSLKEQVGERERSLEEAKLDLETLRTDQES
SASAQLQELQSVREQLAEVTATAEQKMREMEEAHSERMQAALTEATQQREKAEQTHAEAV
TALESSLSDLKSELVAKTASLDAAKSSLEALQAELDQANESNARLTEEMASHQQTSAAAG
AQIAGLEQQVSDMKEQLHTRQADLEASLDQVSGLRKDVASHQQEIEHLQQAAASKQEEVA
QLTTQLETAQQERDVVKTEVQEKQEQLGTAFASLQQAQQELETAQQERNAAKTEVQEKQE
QLDTACASLQQAQQELETARMSFEEQNASMAKQHQAAITSLQKEVEQLTNCVNEYKANLD
AAESKTSELSQDLSSANNAKVTTLQELEQARMALSDKGAELEALTHQLQNLQAAKVRSEE
EVQAAQQELESVRAEMQTLQDKCNESVERAGELQSQLDDTQAQVTELKTSLDTARAELRA
AKAEAKAAQGNLQDGQLDMAKRQAVLESDIAALEQQREVLRDENAAVRAEVEAERSRHQQ
AAQALETAQGRVSDLERQVQEQEECIASLRKDMESACKRVRQEIGDAAQQQQTAQEQRLQ
EALAAAEDARKHLEEAEGDKAAALEAKSAAETARAAMERELQRAQKRVSKLEEQLEQARG
RAAKAAAEVTASEQTKASTQQVSELSSKVEELKSALSEQRSSRHKAEDECEALEGKLKEA
VHAREKMESVVIQLTRANRRLELVLEENGVRLPSSQRMQDSALLSTSTVAAMTADALAGG
DDAKPKDSKTSTTHAAGEDGDIVPHTPRAVRPKLAQHTSKQNTSQAADESQDGNTSAMGA
SDGTGAAPSSAFRRLRSTASSGVPPSAMKTRSTLRRASNEEEDGDSANTSTRSKRAKVTF
ADDTKNRDGPGAPTSTASKKEPASSTTQTGPATRRRAPTLRSMTLRPSSSSSSSSSTTAT
TTTTTAAATATGAATVAGGARKPLSARNGENVDSPSKLPRSTRSARRAAVAEKARAGTAA
TAAAARRKRTLQNNGEEVPPECNNQ
Download sequence
Identical sequences F2ULB2
PTSG_09546T0 XP_004989975.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]