SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09548T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09548T0
Domain Number 1 Region: 1146-1468
Classification Level Classification E-value
Superfamily NHL repeat 3.27e-33
Family NHL repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 472-544
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000167
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 536-605
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000556
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 340-396
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000264
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 5 Region: 390-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000334
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 596-662
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000639
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 7 Region: 839-903
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000862
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09548T0
Sequence length 1470
Comment | PTSG_09548 | Salpingoeca rosetta NHL repeat protein (1471 aa)
Sequence
MAHAVLVFAVFLLAAATQTQAYVNCWEDRRWNFACASAGVGTTGQTSRSGGLDFNQFDRP
LSFTCPEDYYLTTLEVWRFECRKIANAYLRGCSTTGYLNGFDQPLNYIASNDRIITGLHS
YHNNRKEDRRWKVSTCKVECDLNSNYITRRDRTCDTISESTLSQGTYVNDFQSPFYVTCP
DNTGMYEVRSYHDNNQADRRWRYYCDTIGGPTAGSKTGWSSADYSRLGLRHTFSCPDNTY
MRGMKSTFVADANDRVFSYQCQAISSATLTNCITQPFQNIFDNALTFNAGTKRVITGILS
DYLASAMDRTFHIRTCQVSCATDYVSDGVKPCSALSLTRGSLSGDCQGYPGDVCSYSSCN
EGYVLSSTGVTRTCQDSGSWTNSAATCQRVTCGSLSLSHGTLSGSCSGDYGETCTFSRCD
DGYAPTSGSTSRTCGYNGWSGSAISCEPVSCPSLSISNGATSGSCNGDYAIDCGSLSLSN
GQLAGGCSGSYGDACTYDSCNTNYELSEDGDATRVCQQDGNDGVWTGTAKTCERIKCPTL
TVANGAVSGDCDGLSVGDECTVSSCDSGYWFSDSGSRTVTCTEVNGERMWSGSLNTCEAV
TCMALSLNHGSVSGSCSGTVGDQCTYSGCDDGFLLSSEGTTTRTCTQNEDTASWSGDAKS
CFELLEGASGETFTLSCASGQGFVGVTSDAQNSAVGDRRDWGFACDDVGSNDANRVWNMH
EEINSARGSFDFTCPHDSYYISGVTTSYLDSPNDRLWGFQCSLIFGATLGNCQLSSSYSA
STFNFDYAVPTGHVLVGVKSSYSTSSGSRSFQFRTCEVQCRTGQEYFSTGGAECQRVGCG
ALTLENGAVSGSCDGNIGDQCDYEQCNGGYTLSESGSSQRECVVVNDKPQWSGQAKTCER
VTTTTAEPTTLDVCSVYKTAPNPTTCRSQCDYYDRGDATFSKSYGECSNVCTCGCRRRFK
ITKTEERCSAHCADQGLAAAFRDMHLGCRKVCLCVDVDAPTTPAGGALTEPDADENALDF
PFSEYNYEETFTGAITGNSNPRRFSTAFETSATIVNMEGESMLQCLRYCDADPDCLGIFA
SVVNGMLRCQLMSDLGSGTGVSTQIVSKSLTKGTQPSAVGTATPSIASAIQTVVGNGGTT
WDSSATLLNTGLNQPDCVTFDGEHEMLVTMVSDHRVIRVDLRTRTSSLVAGTGEMGADGV
GGAATSAQLNRPRCAIADVEGNVYITEEGNHRVSVVDVVSKKLSVFAGTGDGGHRGMGGV
ATAAQIHSPQAMAWTEEGNLLFSDEENHVVYMVNPHTTIISVVAGTPRVAGDEGDGQLAI
GARLNMPAGIAVYDHMLYIADSGNHRVRAVDLYTQVITTVAGTGVAGFSGDGGLPTDARL
DTPRGVAVHSSGSLAIADSGNHRVREFNIGVGAAGIITTTAGNGQRGYNGDGMVATDTAL
NFPTGITFSPLTDNVLFVDRRNRRVRQIWA
Download sequence
Identical sequences PTSG_09548T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]