SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09549T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09549T0
Domain Number 1 Region: 248-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000203
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_09549T0
Domain Number - Region: 187-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000595
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number - Region: 894-932
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0106
Family Cna protein B-type domain 0.027
Further Details:      
 
Domain Number - Region: 341-374
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0216
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_09549T0
Sequence length 2304
Comment | PTSG_09549 | Salpingoeca rosetta predicted protein (2305 aa)
Sequence
MADATAVALMLFVLVTTLHQFAHAYENNWDDALSFRCLSGKGITSIDSYHSNNREDRRWA
FECSRYGSGYGSSYVTDYVNNFDHSFDYLCNTNYYIEGVYSYHSNEDRRWKFRCRRITGA
TLDYCSKGNYENTFDDRLEYTVRDGYAIAGFASYHDNDNEDRRWQIYTCQINCDSSDGYV
SSGTYGCTRVSCGSLSLTHGTVTGDCGGTFGDQCTYDSCDDGYELSSSGTAGARECRIVS
NEGSWSGSPRTCDDINECTTGTHNCVSPATCVNTEGSFYCNCPYGDLDSSGTECDVDGPS
AVVTEGATSISLAISDATAYPKYEISIGQWALDLSGTTTLPNYPVTVDSPLTSRTFTGLN
PGRRFQVTITPIDNDDNLVTGVQYVGGESSGDIATHCGCLSSDRTGAPSDLALQQSLGRV
FFAWTDQSYCESGFSFFRDSVGLSANYDVTSEETCGGEHAPTTVYDDLTVQRDDVYAELD
DGSFYAMPEGTFFVRVTSTFDTAGSRFAYPSELASGGHFTSTSTSSTTSTSTSTSTSTSS
SEVTTSSTSTSTSTEATTASTTGGADLFTTPGVATTTTTTTTTSSTSSFQSTTTSDTDEV
VYATGTSTKITRASECATLCKERSEWCLGIVVQRTTSGLVCHQLKLLYFASVSQDDVTVE
SYEAVTVSNTGVSGTYILDGSKDDCMQACSDDSDCAMIFVGTSYCATANARTTTSTNPTS
YHEKALPTYFRRYVGTAPGVSRRYCVVATNPVDYDSSGYASASTCKYLTIQWEVIVRGQV
TIDSEEIHLAVEGVEVSFEVGGVTGTRTTDEDGFFEIHIITDQITSLHETMTLSFSKYTG
SIEHTFSCGGMACTETTVVVEHLRFDHEVDIRDTTTMPFSGRVTIEGTEHQGYSNGCPLK
DVEVCLYDRNQGDYVVGCAITDAQGYYTAEAVLGASVGTFVTFGNSSHTFKRVTYTENTP
NAPSGYYIRQDPVTSQDVSTPYYDITEDKLWERIDFKDVTTDTATVDVAGGKCNLTLGRA
TIEFRYDNCPTWVRTERTSDRVSKWDLPAQIITVRFQRLVRDGNVREEMTRYFSATLGES
RSKYVDLRDPKNMNNTLKYARFEYHPAPQLDISFNSEKSHSCSYSDGTPLRVIQQNTQTL
VTIKVTEDYGNSVGTCDIVPGTIEIENHLGESPDTVAVLNETMPSLTNSQLKLLERCYYP
CEMPVIMDTTSTASGDTLSNSRAQFNILTGSPQTNPEALDSDHPHTKLFRATMQRLPHDP
VTESLYVIVTGDVAQGTGASIPFPRYKPLLVVQDPPGGLSSATYSNTYANYKIESDTYEE
YGGFFFGLEITPFKVDATLDLCVGLGAANCINLLTAKSDPATILADTTNLFGTKDGNDNY
DTEKVWSFSLDVTTSEAEVLAGERSDMFLVPSLNVMFLDTDIVEFDTDTCDVTLRTETTW
SLASGENDEAMAWLSAYEIETKELPDLRTRLANADANGDSEDMKAELQNAIDAWEENLAR
NTEVRDMAANGELNAIQQLWSPDTFSLSGKNNINGQMNKGIALAPHKLIESALQLNDTAA
TDTQQTGLKAINTIKFSGGGSTYTFAYDTSVDKSVTDGTMREHDFQGGTSVSFDIASSGV
GAEFTVTPLGIGHWFASHEDQEGYQEEEHVEFTLGDPDPFDVFDVQVFKHPDYNTLVFHT
ASGQSSCPHEENTLALEQPGMTVLKRPEAPVLPNEPAVFELVLRNDGDYTTYMQLYAVNG
QNQDGLEISVNGWPLVAPIDYVGFEPGATQITVVMKRGPSAYQYDPVDLWFSSLCEQERL
AETGYLSDEAAAQVRVTLEVEFLQPCSPVQLVGEVGEEGMFVVNQATDEQEERPGELRLV
AFNPDFAMRKWTEDDRLTGVYVEYKPVTSTVWLLARDKDQEALDIRTLENDYGYVTMWWS
VESLSEGQYQVRIRAQCQASVNEVPDGIDEQYSITAVGVVDRTSPQVMGFPEPADGVYEP
GDDISFEFDEPVQCSKPFQFGARMDVTGVDRVFDNTNMVIVCEGRRISMSLRRGFSWDEV
NARSARVLLTTVEDPYGNRVQQDLTHLFEFANLELASATTQVTGLMLDLPFEQEYYNTTS
AAFENVTNIIETDIADALGISMARVQVIAISPTDPLDYTVGITIDTYILPTTIEELTRRR
GSGDDMTSSALADLLQSLVSDSNSTDIAEGSILNHVSPLSNVEVTLMAASRSSNGTATPD
VVTDSMLSTGNSSGSGDNDIPNYALLVVLIVMLIVQVYMCIRMTSKHRAKYDMGASPAAI
ALSAKDGDRRSSFEENPTMDFTHV
Download sequence
Identical sequences F2ULB5
XP_004989978.1.12839 PTSG_09549T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]