SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09649T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09649T0
Domain Number 1 Region: 49-405
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.37e-101
Family beta-N-acetylhexosaminidase catalytic domain 0.000000442
Further Details:      
 
Domain Number 2 Region: 11-47
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 0.0000366
Family beta-N-acetylhexosaminidase domain 0.029
Further Details:      
 
Weak hits

Sequence:  PTSG_09649T0
Domain Number - Region: 423-522
Classification Level Classification E-value
Superfamily Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) 0.0746
Family Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09649T0
Sequence length 995
Comment | PTSG_09649 | Salpingoeca rosetta predicted protein (996 aa)
Sequence
MPWCAIIDSASWGAMYALETLSQVIMFNDVTSAHTISHAPLEIWDEPSYPMRGIMVDSAN
HFIGVPAIKRLLDGMVAVKMNTLHWHLVDSYSFPMQVPSRPMLSRRGAWSNTTVYTRADM
RAVQEYAQQRGIRVIPEIDVPGHAYSWGLAYPDITVECPKIHTTDIGPINVVPLDPTKEL
TYQVLEDVLAETTSLFPDAMLHVGGDEVQYECWRANQDIQDWMKKNNISSEQQLEVYFEQ
RLFAMLRTHNRRAVVWDEAFTDMHDHLDTSVVVEVWDDPTLLERALRAGHDVLFASGWYL
DRQVPYGNMTHWFWLDTWADMYAVAFPRAPAGGGRILGGEAPMWSEQVSDLSIDARVWPR
ALAAAERLWNQNATDHFDAAQRIGVHRCRMAARGIPVGPIWADYCSHDAQDVNIHQLSSS
HHHSVNMTVGEMSALLVFIFLLGVAVVWVFAACFGVGFRVRGRDDTLNAQSVAAGTAGSV
QHAKTNEDEVPLLAVGDTRPASSSFSRASRMAATPPPPPTSSSSAAVAAARSRSNTAASA
SARGTLDAQPAQRSLPKERLSSLDVFRGFTVALMVFVDETGAAFPPIDHSPWNGVRLADF
VMPFFDFIVGVSLALSFKKFDLEATIRFLKLFILGMLTQGGIDIMNYDLAHIRIMGILQR
VAVCYYAVALMEIFLPRNKKYRNYNETDTVTGWAVDVLHMLWRYKWHWFTAACLFATHTG
IMYGVNVPDAFGEECGRGVLTPACNAATYIDRNVLTVEHMYFPANGGDKSGNDVTFQRLP
ECSTCSPGKCVPPEDAPAWCLHGPFDPEGLVSSLNAIIATVIGIHYGHVLRRVQSPKARI
VHWTAFGVVQLVIGFALHFSGAFVMNTDLYSISYTLVTAGTGGVLLALFYVIVDRLHVGE
WAWSGCRYMGMNAIVMYLCAEGDIIPYVLAAFYWNKPENNLANILWPTGVFWGDGDERPF
KPTYNYQVMLWTLAYIGVWMLLARYLFLKRIFITI
Download sequence
Identical sequences PTSG_09649T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]