SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09682T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_09682T0
Domain Number - Region: 449-484
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00706
Family TNF receptor-like 0.0036
Further Details:      
 
Domain Number - Region: 215-252
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0106
Family TNF receptor-like 0.0063
Further Details:      
 
Domain Number - Region: 492-528
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0297
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 413-441
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0518
Family TNF receptor-like 0.0075
Further Details:      
 
Domain Number - Region: 252-288
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0753
Family TNF receptor-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09682T0
Sequence length 546
Comment | PTSG_09682 | Salpingoeca rosetta predicted protein (547 aa)
Sequence
MDAGSTSRRICIWWRRTRAVASACIISQEHVCHPLSLAPQVLGAAVNRGVISTEMRAFNN
LNWHRGGGVLQKIGLTNPFFSGEYAAAHVTGCQDGPDKKCKKMAAGLRHVGAHSVETNRM
TFNGNISTFDLWDTETLHGGEDMELRETYFTTNGNLAQAVQQNRTAIHTVHNNTVRRARP
ADPTLTSSNGHCTSKWPDGKYELGQRQPHQSRIAHCPLHYYAKDHGYVPCTTCGMGTWAS
APCSSSSDAVCSSWTECKPGQKESVSGNAVRDHRMCVSCTRGMEYQPLPDRASCFPTSVC
EEPFIETIPPTLTTDRLCSCDTLACNKLITQLFEEMVCAEPTDEQLDVDGIRDTIRQMDA
YEARRSCPGCTDTCECSAGFILVYDADSADCRPCDGVTEFSPSVGGSKYEPIEECELGQE
EVAAPTRSSDRVCHDCSARTIDLDSDGSTGCQPKCAPGFEEVQAMTLLISDRVCDECPGG
HVQGCLWPARACSCFPVTTCDAGEEETAEPTPTSDRVCSQCELGATFKPVERPGRVMPPR
HAVRSG
Download sequence
Identical sequences F2ULP5
PTSG_09682T0 XP_004990106.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]