SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09707T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_09707T0
Domain Number - Region: 418-465
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000389
Family TNF receptor-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09707T0
Sequence length 670
Comment | PTSG_09707 | Salpingoeca rosetta predicted protein (671 aa)
Sequence
MPPCLSDLSIASESVVAYAPLTVLLSDAPAGTYNVTLALYASSAVTHVETFALPSFTASK
EIVLPCTSVPQSAQYTISVYDLSTSNDPISKQVTVSPPLFQLFLSASSIIARTTDIQATM
TFPKCAGAPHYLRVHYDGTTDDQLLHEQEFDDSLSDGGESADVSLTLTIPGSVFYRNGTF
HIGLWDSLPFYSFSLARVVKQVSAQWGLFGVSVQSSTVTCNTFNYPVVFPYSAASTGEDD
YIEVFTRHDSVVNKTLPFANTAFAGMVSMTCGELTSVLGVSVSGTVRVRYVIVSLPPPST
PPTAAAHAASYVPAQAAFHLDLSLLIADARLTLSPPFPIALEPFTVHCSWDSAPNATSYI
NIDGTITVNETATTIAHGDSVHVSCQVSVDDVVVLLGPVLRPVCPGSDACTGGVTFLSGT
CSLDTVTWTDCPPGTFVRTPPTPTSDRVCGSCDGVTGFSTESNVVLCTLPRECPGVNASM
TVPPTPTSDRLCELPPPIAFSALDPIVRIFGFNPLGTPFPPQVTITSDHDIAAITLAPPP
PATFKIGTLLATVTDTAGHAAQYAFTASTGSSDGDFRPFPFTLDNALRVRVLEPSPLAEE
VAFNITTLASEMLGMYDIVLAGVLRSNTANETHNEVLLASLVPTYSGEGGSAGGEGAGGG
GGELAPTHGV
Download sequence
Identical sequences F2UNT6
XP_004989062.1.12839 PTSG_09707T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]