SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09718T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09718T0
Domain Number 1 Region: 44-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.22e-27
Family beta-glycanases 0.016
Further Details:      
 
Domain Number 2 Region: 404-497
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000000104
Family Ricin B-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09718T0
Sequence length 689
Comment | PTSG_09718 | Salpingoeca rosetta alpha-L-arabinofuranosidase B (690 aa)
Sequence
MFVFVFVVALLAAATVAVSVSSSSSSSFVVDVCVGCEQQRGFGGFGTSLCWWANGVGRWT
NTTAFEDVMQLLFSDTRGLGLSTVRYNIGGGENPQNAHFLRPGALVRGYQGADGTFDWGA
DYPQRRVLYAALNGSVRQVQAFSNSPPYWMTKSGSATGAVGGSNNLRDDMYGAFAAYLAN
VTVALAHGPPDQAPRCQQQPPWQPLGDALVSVTPLNEPVSSWWKYGNDQEGCHFDRDKQA
AVIAALSSQLRATAPAPSAAGGRGVGVSGPEENSIDDALLSLQSYPAETLAGMDLLTTHT
YNGIRREALAAFAQKHGKQLWNSEYGTGSGPLQGGLELASRIITDLHQLNASVWTLWQTV
DLDNSLSPDGWGLLAATVHEENLYQIVANRSHDGDDGADGAGASCCVEVEGVADGSNITC
SPCDVNNPNQVFSVVDGQVRAHNSSGPCMDDWGQGMRAGDSVRVYSCWGSANQQWVVDAA
TRRIRLNSTGLCIDMRPTTATAADATDAIASATTTSRPSGTRPQPATSSVLDTPGYEPRD
RVREAYRVRKQYYAYKQFTRAIPRNSTLLRTNTTASRGDGVVRSVAARWPNGTIAVVLVN
TGKVNQTGSVVLSGGSCSTAYATLTDATHSFQPWPVSLTHHSTPTNNHHNNNHNNHNTPS
HNTTARVALPPQAILSVFLCGGGVTNICK
Download sequence
Identical sequences PTSG_09718T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]