SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09771T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_09771T0
Domain Number - Region: 463-499
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000942
Family TNF receptor-like 0.0081
Further Details:      
 
Domain Number - Region: 420-464
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00124
Family TNF receptor-like 0.0047
Further Details:      
 
Domain Number - Region: 1002-1032
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00312
Family TNF receptor-like 0.0031
Further Details:      
 
Domain Number - Region: 285-327
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00391
Family TNF receptor-like 0.012
Further Details:      
 
Domain Number - Region: 378-422
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00536
Family TNF receptor-like 0.0071
Further Details:      
 
Domain Number - Region: 982-1008
Classification Level Classification E-value
Superfamily TNF receptor-like 0.033
Family TNF receptor-like 0.0042
Further Details:      
 
Domain Number - Region: 580-605
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0518
Family TNF receptor-like 0.0062
Further Details:      
 
Domain Number - Region: 774-806
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0824
Family TNF receptor-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_09771T0
Sequence length 1161
Comment | PTSG_09771 | Salpingoeca rosetta predicted protein (1162 aa)
Sequence
MAFRSCSESCSSCDDSCDSSCIINDIGCDSSCDTGCDYCTDCNDACDESCDGDCDEGCDT
CYSGCDSGCDICYDSCDDDCNGDCDYGCDDSCAWTYCDDYCDDGCDTGCDGPCDSGCDDS
CDDSCDTCTPISCDTGCDSSCYCNPGYYGTAPYCSYCGTGTYMPYYGATNCYACDNCSPG
EYRSGCGGSSAGTCRACASCPAGTYRYKCGGQNSGYCRTCSSGTYKLVDGTSGCTSCTAC
PSSTYETSPCTSTSNRGCTRLTVCTGSQYEKTAATATSDRVCRGLTTCGAGEQEKVAPTA
SSDRVCEACPAGTTDANSDGSDACVTCGGGTYVPAGSTGTCSQYECSAGTADTDSNAGTA
CEACDGTTTYQPSKGQERCLSVKTCGAGEEETTSPSATRNRVCQPCQLGSTFKAQSGQST
RCISVTTCGAGEEEIASPTLSTDRQCRTCASGTFKAAAGQGTTCVAVSTCAAGFTEDVAP
TPSSDRVCVECAPGTFKATAGDGTRRAHRTCEDTEYETVAPTSSSDRQCKVLTVCQDDEW
EWNAPTTTTDRECLPCGTCADGLLIEAECTDTSPTKCVGCDECAPGQYVAVGCTLDDPTQ
CADCTTCGSDEYQMKGCNVLQDTECATLTTCSSTQFEVEAPTATRDRRCKDLTACQPGEY
ECTAATLTTDRECCGVTQCAPGSEETSAPTATSDRECRQCVAGTTDADGSGTTPCVACSA
GHYVPRGRTGGCAAFECAAGHVDQDEDAATACKLCEAGVNYAGSAGLTRCTSVSECGAGE
EETSAPTASTDRVCSTCASGKFKATTGQTPCEAVSTCEEDEYVYRAATVSTDTQCRALTA
CSDEQYETRAPTVNSDRECTGLTTCGSGEYETRAPTATTDRKCASVTQCDLTQFVVSKPT
ATTDRDCAECDRCDSGTQYETATCTATTNRVCADLTVCADTEYESVAATDSSDRKCSSCR
ECTSSEYLVSGCSESANAVCKACTECPSGTFVSTACTPLADAECTECTRCGSGYFVQSPC
TSEADTTCKRCRSCASGEYLHTACTSSADAVCRKVSTCDVDAGYEVKAPTATTDRECRAL
TTCDGESEFESRAPTLTSDRVCSKLTTCTSSQYEKTAATSTSDRVCSKLTTCTSSQYEKT
AATSTSDRMCSKLTTCTEQPV
Download sequence
Identical sequences F2UP02
XP_004989126.1.12839 PTSG_09771T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]