SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09788T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09788T0
Domain Number 1 Region: 597-848
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000304
Family All0351-like 0.009
Further Details:      
 
Domain Number 2 Region: 427-474
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000163
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 3 Region: 459-510
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000541
Family TNF receptor-like 0.0044
Further Details:      
 
Weak hits

Sequence:  PTSG_09788T0
Domain Number - Region: 512-542
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0032
Family TNF receptor-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09788T0
Sequence length 861
Comment | PTSG_09788 | Salpingoeca rosetta predicted protein (862 aa)
Sequence
MDRNRGFDVFISAHREAMGEALALRDRLRNVQLLGEQRGAPTVFLRDERMGEEIMEGALR
NCSLVVVLASSSYGTGQEQGDLRYVLSEGKPFLAVKRDDQLQVEWVQNALNGTNWLSWFE
EREQQPQPQPQHQRFARIEVRWQILRRIRDTLEALQQRAPDEEHPRQPWLARTVLLALAI
VILGQAIFGVTQQSLLGQVGESGHGWTNLQVFQRLDAIERRLEHLEYVDERLSDVEVALI
DMEEVMDRVRKLEKGAHAWMAVEDMEQRMRSLEEGFQDQTHLRDMVHRVNALEGQMRACT
AVQDVEKRVRKLEKQMKSRSTVDCDTQDTDEDVVGQLVTLEVQMATLEDRTSTLEEHDEA
LASLREQLHGCEQLGDVVADQAGTCYFDSGSCPPLNVEPDVIVEYPHGEQVSTALWGWEV
MVWHPSGGAVAAALQSPGIVLRFHCSRDHYVSGHISTTCLRSLQWSHQPPKCIPLTNCRP
SEYVEAPASESTDRICATCPPGTFSDSENAAKCSVVRRCSPGEYMLREATPTSNRECKQC
TTRAETITRPLGTKPETDVDDWADLVLAANGVFYGIPAHATSVLAYNPNGTVHAEIDVSF
YGDSWKWSAGVLADGLIFGIPYDAAAVLVIHPSSDSISDISVECGRTACWKGGALAGNGK
IYATPHHADEVLIIDPVALTVDTTTIIGLGLGWKWAGATLAQDGRIYCAPFDRGSLLVID
PTTNTAEEWGVMVLDTNAAAFSDIITAANGLLFAIPFNARFVAVADPKTRDFAGISGLSW
DGSKWGAARLDRFGRIVAMPYRANSVLLIDPDTGTIAYNSTTTNGCLGAATTRDGIVHCI
PNHTQDAMLLVDYPCDSRKKP
Download sequence
Identical sequences F2UP23
PTSG_09788T0 XP_004989147.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]