SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09794T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_09794T0
Domain Number - Region: 873-910,942-998
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00255
Family Proprotein convertase P-domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_09794T0
Sequence length 5282
Comment | PTSG_09794 | Salpingoeca rosetta predicted protein (5283 aa)
Sequence
MSARAVAALPWLPCALATVVMILASLNVLVAGQSSFTLRQLSSDLPREGDLLEFEVAFSG
PPPVDVEIRIAGTNTTQVADAELFINSTNWNTTSHRFLAGPSANNFIQVSPYSIPLVLQV
TTPSFVSDMVVDMVALDNNTADVLRELDSSRPYPQGAVPEGTYVEYLLTLASIPTHPVVV
DLVVDAGLVSLTPQRVAFEPTTWNVPQVVRVAVPDNDVYAAAAVSTDTVEFHVSSNDTNF
DASDQQNLNITVADDEAGPSISFASLRWEAVPYPHGFVVRFDVDIAAAGHDARTPRTLHF
GDGNSAQLPSDPIYLTDAFNQTIVRYTMYHTYARGVDRSQRAWVEVCCVAKFVSTTIDAP
LTLQADVQLNLLQNTSSPFVPAVTAWQYHARPLAINATTHVADDTYVPVTHVRGWASPYA
APLRYAIANSAVGGTVHGVPAWITIDPYMGVVIVDPAAAYPGQFLVPVRVSNVLTDASST
YTFVLDVPASATTIATDSAAATAAAALATTSPLDAAAWLSRMDQGYTDDVDAAVADLVSA
IGTGAHEDFARGDSPLRCVTDVQDFVSACVVQTAFGGSATVEAMATALGNATTYTLHTPG
AVAPLLASTAGADGTYLPALPSIADSAQASATPPGAPALYALAWVVGVQDGANETLALIP
EDTHVAVGSGQDVLADVAALGSDGIDVQHLTHTSLLVTLDAHAIGTGAGDLRAAAESLVG
TLTLRLQYTHAGLKPRAGTRNIMVAVGDSTGLVTVHAGSVEPAPTPVAPVLDLDPTDPAS
SDFATVYYDQQHSTNISLTAQPDGMVLQQPRAPIARATVAIHPAMDAPYEMLSAPYEAPT
ASWPPAVFSSSESLHFAQQGLSTITVPHSSAAAARPVTDVVIAVHVLHGQVGDLTLALHR
HGRPYVLAEYVGGPSCDAANLLATTFTTDSDIPLSGRADGAGACVPGAQGVFRPAQSLAA
LLGEYADGEWTLSITDAGVGAGSDTTRGLLLSWSIAFYTDLSSPATAGATSSSNSHGAVG
ALPTGAAVPFASPVYRSSTPVPRLGALAAPRTLPWHEAYSNSNSSSDSITARDTITIDDV
QGRVRSVVVEAHLAYPPTFVGSNATVTLSLQHGDDNVTLMQYNRQEAIAALLAGNAAAPS
ERCVPEGFFAFADDASLYGDAAASSFAMADLCAAVAGVDAPPLRLGAPAEALAAFAGSRV
TGEWTLVLEADGSPVAVGGWAVRFSLEPNVDTAFNATTGVLELWGVDSPDNYRAVLDSIV
YSNDAPTTEPEPLRNITFTVVDDLGTEATASALVAIHHLLSIELLPIDEDDTTSQGKLNR
VSTMLALTTPPNADANDNWPERAGYGVVITMVDNSNGDWQYSLDGGHTFLSIGNVSRTDG
LLLPGSDVGDGVVDVGLAEPWNTTILAAGSDHAYEGLVRFVPSKDFHGTARIGFSMWNTD
ALALPAGTRTDTSKHPVSLHNASAIATLEVLPVNDQPILTANGVLETIVEDDVDNTGTLV
ADVVAGIFFDMDTLSPVADTFSDEMGLAITGVDRRNGDWLWSCANEEAYYDALLANTANG
TANSTVSTTAAFLNGTALSATFVPFIGGILPNNDTWPPNPTPAMATVLGPGCRIKFSPSE
DFNTQLTTAGEPWSDASAIRPWIRALPWDMTDDIASGTFSVDTRAGRTDVTSPFGSTPRF
LYINVTEVNDAPQLRMGGPGDNYSTVYVEGHGPISIAGPAFVVADPDNAALASATLQLSG
VADTLEYEHIVFNTTQLDIAGEGNYTLTYDATAVVNGSELHAAPTSASIPVLLHLDDAVS
GARLTVEAAPLNTTAHDSSSNGTAASNTTVPSTMTTGMVVRVWCASDVATGTKCPLSLFR
DVLLAAQYVDTLAEPTNGTRTIEVSVSDGLATTRAMTTVIVVHTLENAPVLGLDAALGTT
TFTEQGGAVSPLAALTLFDEDHNEFYGIAAAEVGLTSWQAGHDTLAVSSNATQHTHVAVA
FNATTGVLTLTGTASVAAYQALLQAVQFANDEDEPRGFERSIAVQVTDTAGLVSNVVVAR
LPIQLVNDHAPVIVMSEPVYTVVEGTDHVLALGGDISLSDADVPASTADRYPPISQHFLA
SATLTLTPLGQGSAYAASFASAFPDGRLVVNASRAAAFATPYANDNTSNDTEVSVITTTH
SAGAYNDTVVVNAGGVAGANLSVRAYADGSLSLVGPAPIEVFAGVLASLQYETWVEEFDS
AELNVSLSVSDGLFVSTASTLLVLEPVNDVPVFSGDAAVTPAPVFVEGSATPMRVFNNAF
RVTDNDNATLPLATITLAPIDTTLAPTSSSSGSSSDADVEVLVVPADVWAAIANVSMQGN
YSNTNGSTTLTSSNSTTNGTSTSLNSTSTTNNTTNTGLPVLRGNGTAVLEVANIGPAALT
QLLHSIGYKHLDANPGNPTPGIRTITLVVTDGQATTSIGINASLEVVAVDPVNDAPFFIT
VGSVRDVVFVEEAVQPVPVFTANRSVMDVDSADMHRFTAALTDAEQESEFVVLGDVATTW
QRYLLESCARLCPSTDAAAWYASTGQNVLSTPTAAASTTSASGSGVLPFSTDTTTATTST
SSSTASTATFDVNGTSTATSTQSTTSAATTSSSGSGSGLLGFSTTSMSSTTSSTFGGDAS
AACQQLCVAVNATWFDFPIPSEASSTVANRKDNDCGVVHGDVVTFSFVDWMVGDRDADAL
LANATQYATDTLAAVLPEMQPAHLHIPCDTLCADAAVADSSLCYYRCSLYRELGKQVDVL
ANTTTEQTVDALSTIAYWNVEDEMQGSSRQVDMQVADDNSMWSSVLTVPVTLVPVNDAPR
LYVDGNRNSTTNITRAITYTERELGTPLFASGAGVVLLEDDDDQLISEIAVELTNAPANS
REGLFLNVDALAPAFVVEFQLSAGPTGPTTSTSSSTTSSSTTSTSSSSTFNGTHSTSTSS
STTMNGTLSTTSSSSSTFNGTHSTSTSSSTTDAPTTATTSTPMTMSSATIVIRDNRTGAV
AIVVESWSPVTVYPALTDYERVQAERGELHPVITAAIPLGHALHMTVNNATLATAQTILQ
AISYTNVEQLLVQPQVERIVRVHVRDSYAAASSNVTVRASLISVNNAPLLNATRLVATQE
EAEDGPGVTFDVLPAYVDAESKPWFAPEQRMPGYVEVMQLPVHGNLTLEADSTVLRYVPA
AEDYGVRPFVVRACDPLGLCSENVTLTVVVQSINDAPAQRSDVLRYDVVEDTVTDIPLDL
FYIDVEEYHLEPFHADIDGAGAMQVTLLPDAVQQAVKPIDEQGILSLYLNTTTRVLRLTP
VKNYAGPANVAFTVCDTEGLCTNMTLHVNVTAVNDVPAVAALLQTRVREDTLTVLPFTSY
DVEDSACPRDPINTRYCQLLQVRITAQPSHGMARLLLSNDTSLPLELRYSIEYNPDEHYF
GVDSLTISSCDSDGGCSTSVVTITVTAVDDPIMLTIEHVNVNEDEVLTLNLLGYVQDVDN
VVTAGGINMTRAPLYGTTTYDDQTGVFVYAPLQHYFGEDSVTFLLCNEAGDCGSATLNIT
VVSVNDVPVVLNTDVEVWEDNTIVVDLLALTSDVANEMAGVLPDTITITTAPAYGSVAYN
ASATRVQESRASTGATGAAAATALAVEGPYGTATYTPNQDYFGEDRFGFTACDGSGACRS
GFVFITVLAVNDRPRVATGQPDPRTGAPTATAILPFTAEEDTLNLLAVYALHDDVDFSED
HVRPSPDDLAAFASGERPDLFLTVYDPPLHGEVTMYSFFGLAGYRPNTDYVGPDAFSYRV
CDPCSTTRNAEFGRIAPSTDPACVRQRVEYGASAVAGGDDDLELGCTIVNVTVQVRNVND
RPNAANLATVVEPTGTAVFAPLDSTRDIDDVQFAHVHALVEATAGNATLQVLEDDYNLVT
DDDIDVASVQVVAQPSSGARAEVVYTHDAVTNTSVPTIVYTPPNHPSLAAANNSDTLFFG
ADDFTYSVCDVQGECDLATITVHVASPTPQITSVRALGACVNGADLIAGMSPSALRLRES
LTCDPDGVFTDAGYGDGDRFLVQFDSATNMPPYGRAGVGLLEEDVLQLFSFSQALKPTAG
SGSDADVSITGEWVDPTLFVITASGSMGAYAPVFSATALNISVPGTRDRLCGQYGHTSAA
PGIITVEVDDMEGKEDAELTPAPITSDDGSIALKTNVERDPYCILSADELSFHAASTVVG
VSGDFGLTLPGVIGVEVTNPPQVEPDYLGRGTVLSVVMQPALPLGLLYKLCSRGTADVFD
LSVLASSAEATLDCSVVLGSDDSEVSASMTEREYACQFEPHTLTRAELAQCTNTNTNNDN
NRRRRTANSGFAVGGDDDGADRDSGLLLSARKRRDATATTTGTATTTTTSTAAATTSVTA
TSNRLRLYFTSLSGLKLKPSDAGFTEAVARMLNTDTLRAAVLGDTFGVSASALDTYTTSR
EDALVALFEQLALGLRYVGNNVETPMLTSVHAYRPTAAFLKATGAEMLGELQPGCTLVLE
FDRDTNTPSTSPASSVDLYPYLSDKAAAAARAQDLENTVLALSQRDVDRLLTFEPSLGSF
SSDTNRTEDAYVGRWTSLSTLEIVIFSPNTVSRALIASPQALTISFTPTSSGNPCVEDPS
PCTTDADNGNWGICNTMGTSCRAYEAFAGQNITGSWATDVTLGGSTSTAVESSSYLYLLL
LAVPAMAVGAVIVYRRSRRQRDKKRMGRLVNRWRSMLGTDLVDNPVLKTTSTDWSRPPGM
TAMRAHSDPFLTEGEGGDPFAGGQQKQQDAQGVPMAGTGLYDSAFGDSVPRTEPFAAQQR
IDAILRSPTQPMGGAGAQQAQQQQQDVLNTSTVATLGKGSRIVLPPLRKGVQRVPSLRTL
DARGQQQQQQQQPNGAGAGASVRDLPPLKRATLRGSQRLPGIPVGPPMELPHMTPSQPQQ
AQQQQKGNARLPPLRAGPASFARKPTLPSFPQGPAPGQRVIRPVRPPGMGNDSAMGGGVS
GPNAFKPRSNAALPSMDRRFTDPFATAGPAAAAAAGTNINGSDVTTTGAGGVKGGGGDGQ
RSTSGSSDPFRRRPSVQRPQVPGSIRRASQGSGVAAQPPMRVPSLKSGAPPPMRMPEMSG
PRRVSLQAPNPLRKMSRPSADMSRPAAVPGMRVGPGAGADLPKLARPGGMPRPTRPVGGA
LPSMTTPGAAMMKPRKNSSDSGEDSGVSGAVTGDTERKSNKAKVQDAMKDASSTEDMSST
TDDGATSTSGDMDNGYVVVEGAEGVETDDGARTPEGRLVVELSDVEGNGGGGGGTSDRES
KA
Download sequence
Identical sequences F2UP29
XP_004989153.1.12839 PTSG_09794T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]