SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09867T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09867T0
Domain Number 1 Region: 28-345
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4e-44
Family Putative alpha-L-fucosidase, catalytic domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_09867T0
Sequence length 439
Comment | PTSG_09867 | Salpingoeca rosetta hypothetical protein (440 aa)
Sequence
MHLDEKWVAKSKQFRPAHWDKPHTTVYDVPKPSPAHLAFHEDTFGVIIHFNYLTYLPPGN
RTPDAVLDAAQFSPSSEKFTAQWLSLARDVGAKYAVYVADHFSGFSTWPSELSTFTVKHS
PWRFGMGNVVADFLESAEEHGIRPGVFYSFHNNWHRHVVNFNATTVDVLFQLARFKELLD
EFGDNPAAQVWLDDGLQGELLIEEFNKIIQTLENSNTTCHHCGSASAAHAVSWMGNELAR
MPYPNWNSQNQDCSDFDGNHYGSPDGTRYCPSHCDGVLNQHFWFWEPYTSDRRYTVPELL
ANYFTSVGRGCNFVLNMGPDTTGFLPKPDVERYLEFGLWRRRTFESPLIESYFMFYTDSN
NKEHFVTTLTPMQTIGNHRYHLALEGLQDAHQLTIACRFLPTKSKASARVSYVAVHDWSD
WLFDDFVAAVQNVTATMGE
Download sequence
Identical sequences F2UND2
PTSG_09867T0 XP_004989222.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]