SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09971T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09971T0
Domain Number 1 Region: 9199-9324
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 9095-9223
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-24
Family Cadherin 0.00076
Further Details:      
 
Domain Number 3 Region: 7285-7395
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 9305-9431
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.00084
Further Details:      
 
Domain Number 5 Region: 8249-8396
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0025
Further Details:      
 
Domain Number 6 Region: 7723-7834
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 8873-9014
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 8 Region: 8146-8253
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 7504-7611
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-20
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 9653-9796,9829-9875
Classification Level Classification E-value
Superfamily Fibronectin type III 1.7e-20
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 11 Region: 7822-7943
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 12 Region: 3931-4060
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-20
Family Cadherin 0.001
Further Details:      
 
Domain Number 13 Region: 9550-9652
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 14 Region: 1251-1301,1336-1413
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 15 Region: 5089-5196
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 16 Region: 7383-7503
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-17
Family Cadherin 0.0027
Further Details:      
 
Domain Number 17 Region: 1126-1255
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-17
Family Cadherin 0.0034
Further Details:      
 
Domain Number 18 Region: 8045-8153
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 19 Region: 3716-3851
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 20 Region: 4052-4157
Classification Level Classification E-value
Superfamily Cadherin-like 5e-16
Family Cadherin 0.0019
Further Details:      
 
Domain Number 21 Region: 7608-7709
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0017
Further Details:      
 
Domain Number 22 Region: 3252-3392
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0041
Further Details:      
 
Domain Number 23 Region: 3828-3936
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000228
Family Cadherin 0.0031
Further Details:      
 
Domain Number 24 Region: 7931-8036
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000004
Family Cadherin 0.0013
Further Details:      
 
Domain Number 25 Region: 8994-9107
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000006
Family Cadherin 0.0024
Further Details:      
 
Domain Number 26 Region: 3070-3177
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000171
Family Cadherin 0.0034
Further Details:      
 
Domain Number 27 Region: 3375-3484
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000343
Family Cadherin 0.0016
Further Details:      
 
Domain Number 28 Region: 9417-9549
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000828
Family Cadherin 0.0015
Further Details:      
 
Domain Number 29 Region: 1687-1792
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000104
Family Cadherin 0.0025
Further Details:      
 
Domain Number 30 Region: 3606-3728
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000186
Family Cadherin 0.0034
Further Details:      
 
Domain Number 31 Region: 5559-5654
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000011
Family Cadherin 0.0028
Further Details:      
 
Domain Number 32 Region: 8766-8877
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000257
Family Cadherin 0.0025
Further Details:      
 
Domain Number 33 Region: 5325-5458
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000314
Family Cadherin 0.0039
Further Details:      
 
Domain Number 34 Region: 4974-5088
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000585
Family Cadherin 0.0019
Further Details:      
 
Domain Number 35 Region: 996-1125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000785
Family Cadherin 0.0078
Further Details:      
 
Domain Number 36 Region: 8523-8619
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000557
Family Cadherin 0.0055
Further Details:      
 
Domain Number 37 Region: 3472-3531,3558-3618
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000127
Family Cadherin 0.0041
Further Details:      
 
Domain Number 38 Region: 4848-4981
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000171
Family Cadherin 0.008
Further Details:      
 
Domain Number 39 Region: 8377-8486
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000471
Family Cadherin 0.005
Further Details:      
 
Domain Number 40 Region: 1393-1521
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000103
Family Cadherin 0.0088
Further Details:      
 
Domain Number 41 Region: 5474-5566
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.0064
Further Details:      
 
Domain Number 42 Region: 8612-8754
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000628
Family Cadherin 0.002
Further Details:      
 
Domain Number 43 Region: 714-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 44 Region: 788-882
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000192
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 45 Region: 5660-5773
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000857
Family Cadherin 0.0045
Further Details:      
 
Domain Number 46 Region: 1587-1693
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000157
Family Cadherin 0.011
Further Details:      
 
Domain Number 47 Region: 189-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000224
Family Laminin G-like module 0.049
Further Details:      
 
Domain Number 48 Region: 7034-7103
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000235
Family Type I dockerin domain 0.0055
Further Details:      
 
Domain Number 49 Region: 765-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000273
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 50 Region: 593-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family EGF-type module 0.098
Further Details:      
 
Domain Number 51 Region: 648-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  PTSG_09971T0
Domain Number - Region: 5199-5324
Classification Level Classification E-value
Superfamily Cadherin-like 0.000728
Family Cadherin 0.0097
Further Details:      
 
Domain Number - Region: 955-1003
Classification Level Classification E-value
Superfamily Cadherin-like 0.00214
Family Cadherin 0.0067
Further Details:      
 
Domain Number - Region: 414-472
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0034
Family APC10-like 0.034
Further Details:      
 
Domain Number - Region: 3218-3263
Classification Level Classification E-value
Superfamily Cadherin-like 0.00742
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09971T0
Sequence length 9883
Comment | PTSG_09971 | Salpingoeca rosetta protocadherin extracellular domain-containing protein (9884 aa)
Sequence
MVRRRMRPSVLSGPQGGRQQQHHIHRNSYTSCTGSSAHAGMRPRERLMARTSAAHGFVST
ARRRAAATALLLLAAVTLLTSTCLCAVAAEVPNPAFPQATAHLERYASSIEASATCGTSD
AATDYCELASNPLRCSQTRVCNNDCPNTEIPAQLTPLFPLAGIPNERVTLNGTEVYSIPL
DESFSLPTVPSIAFSLALTPSFFDSRPLVGVYTEDDELVFELQVDTQRQRLVLQYTAFVD
SRQLQEFSVPLAIPSSLYDGAEHHLVFALHQLRATAYVDGAFAATAALPTYPDFMRCVPI
LQSFGICGPDRLFLGATPAGVAPQDNYMGTLASVMAADAALVEQEAASLSTAALRTEPAL
TALVGGARLPASTCLCPRTYPLLLRADATQCATAASEGQGISGTARIRTGTGAFYPEFAL
DEDPTTIWQAPRGIDQVNLTLTLPVQQHVTAITLKFQGYSPRAYDILFSPTSSPSGADGD
SGDTSYRHIVAVRESCPEPAVSTPLLDGGSPLICIPAVLGLQRTVTLTPFTDARVLAAAG
DVSTWQASETLLALSQARRIRIRFLDHGILDGFLSLQQGRYYALRDVAVAGSCVCNGHAE
VCGPETGFACQCEHGTTGTACTECDTLLNDAQWQPSIVDQPSFECQPCECNGHANACMFN
ATLAGQSGTSNLSGGGQCVDCGANTTGPKCGQCADAYYLPSNVAINSTDPCEPCACDARG
SRAFTCQQGSGQCACKQNVVGIKCDTCAPGFVNLQASNPDGCELCTCNPTGTVDGASVCS
AEDGADPCTCKPNVRGFSCDECAPDTFGFGSDPTNGCTPCHPQCQGGCTGPTASDCASCA
NVHLANGTCLATCPPRFYPTDDAAGDGDGAGVLCSPCGDECLTLTITPATVELSEAADAG
NLVAQITFSSPYNVLGPDPALQVAFAIDDAAAPFDIVVDEAANADPSTQQGTARVVVGSA
GLDYELRQRYILSVQASIAGAGVTTSSALTVSVLNINDNAPQITPSADFSLAIDEESPVR
GRVVTLQSVEDADLGAAGEVDLALTQTITDVGNGGSSSSSSSGAGGGGGADDDEAYFTLN
GYAIELARRLDYETGPHAFELVVTATDRGLPPQQTSLRVTVTVNDINDHAPASVQPSFQF
DVAEETPTNTRVGAVGVSDPDSGDNGRLAFGITTATGYIPVTGVVPIAYSLNGGRGDALS
LPFNIDASNGTLYRNDVRLDRDNRNPTRYHLTVTVTDAGTPPRATSVNVTVNVLDINDNA
AVFDSDEERVQVPESTAIGTMVAHFSAVDTLDTAPNADVTYHIGAWRAYVAASSVPSTGH
GETPAWVTVAEGDAASATQLPFRIDRNTGAVEITAPGLDYEAVQLYNVTIVAVDSSSEPL
PAYAALRVRVQDVNEHAPAFSVGEIACVLPEGVYTTTADSNDAFVCATVVVQDQDASYNN
SRLSFSLLAVDQDAPASDNLALHVADVRQAGANAVSTTTLRVVVVGVLDYETTTHIRARL
RAQDAGTPQLSSLISVRVNITNIEDEPPRLLRFEPNTRLRDNAPDATSVPVVAPAVSAAA
VQQYQPPRTREGAADGTPSLFGRIEINATEALKTGVTLGAFVATDPDTQDNQQQQQQDQG
QQLWFSVVNASSATDAPFVVLSNGSMVLKQPLDFESEWRHEALLAIRDATGEEMAYYTLV
VNVDGANDNAPMLADGSTSIRFAVQENTPIGTTVHVINAVDADTSDVLSFSLQANPGVTV
PFDVQGNSLVVAGDGLDFEEETSHAFVIRISDNGIPQPQSTDVLVRVQVTDVDDNPVVLW
LSDNANITYGENAAPVPLFDGARLTDADSSPSSVFWLAVCAHIAGSSATTAGELDPTTQL
DCAQTPPYRRRLLPTTARKCGVASAASVFNNTNVLFGSWSYDSDLPFTVSDGEASGGVGD
ASAFVTFDSDALRPEAQELPGDDGAWPLAIWVHAALPAGTAGTLLRKEAADGRLVLDMAV
VAPDVGDDSWLLRVSMEARDTASVDSGQLLRHIVTFELPSNAGDTEDALLPEHFAIVAFS
STTPGEAQPPVLIAANINAEAGVGEGAWSTFSSPSWQLEATRVQQQVVDEATAIVLSTRD
VAGVSAGALQDAPGPLYLGGAPAAASSSLTGAVITDVALVGGETTTAADVVRAVQCASAS
PCGGQLVAVLSGASDESALASVRVQRLAGNAVNITNLASLDEAQRVLRALHFTNTAVEPH
LALRTVTVYAATSSPAQSSSDAGGSDSGSNGSSGVGSVLGRVSVRVTPVLDERPILDLSA
SADPLASDTLQWLVDTTVEFVEGSEQGVRVAPLQTTRLLSLDNAPNPAYTRAMLTLENRL
DDLEGGSDRLQVMNAGSADPFTVSSSFAADGSWHRLELVFDQEQQQQEQQQGSSASASAV
LSALNRVVYVNRVDEPTPTPRRVTIRVLQQQQQQSMVDASSSSSSSSSSSVQAAATSGVW
SVPATTTVGVTLVNDPPVVLFAREGSPDGDNIAFRYREGDGAVLPLQNVLRITDSDSANL
TWVAVRISSTLKSGEQLDFSSSGAASSPLSLERVSASHLILRGPAPLSVFEEAVASLVTY
NNDFSVAPSVETLLVVTASDGEDTSNSAGVTIAFSGVNSAPVVGWEHSTGDGSGNNNNNN
NNNNNNNSSSSMSILANTYVEDHDDAGDPLLLLPSITVEDVDSNILALRVVVGGLLDGGQ
QEVFSMLDADAQFEPQVGDTSWALLRQGVMTPAQAQAYLRSIAYANRRAEPTAGTRTITV
QVIDTHQAVSATFTARLLVVNTNDPPLLDLDAFTVGSGFSVRVPDSTAPQISHISRFDNI
TVAFNRANSPSFVGSVRGTVSGTQRATVAYRISLYRATSTDSSGNPSSFVESGTVRLATD
SSFVLPTSTAGVKYVRVFPRDSGSAIPGTCANVVACSRNAYAFIAVPATELDALVVSDII
TRPFISDSEGQPLAGLRLHLSNIRDTGDGSSDGDMMDVTGDEGLYVDEEGVAWALGLDVD
VDSTRPSASEMEVFVQFRRPASLVEAATVLGFVRYRNELAEPTPGVRTVAVRALDVDGLE
SEDVYAQLDVQQSNDNVPVLVDPHTIYVREDTTPGSIVATVTCTDADAGADGAIVGFQLL
LDTSFGSFGIGSDGSVYLLQTLDYELGFQSAFLHVLCRDGGSPSQATSGLIELHDADQDT
DLAVATVIGNSDALFSIEVDNSFDDGSEATASDALLRVALAGALDYEQHAQRSVTVVVSD
GVHSVPISVTLDVEDVNEFAPEIVFDPPTSPASVSEDASIGTVVLTIVVTDRDAGPQGVA
SPPDVDVAFFAGSGAADGNGTPTTAFSYNAATGAVEVAQKLDWTEQNAYWVNVTARDGGR
WSTHATHRISVQDVNNNAPAFLDTNLAFSVDEGVVGEVGALPFEDRDSDAFSIASFTIAA
GDEQGKFSIAQDGTLATTVPLDHETQPQYFLVVSLTDALDASLGTSFISVVVNVNNLQDE
VPVFLTADGTPTPAPHPTFALNVSEAVQVNTQLLQLNVSDPDHDSNGDGLADGGRAPIPP
VLFFGIELGRRDGDVFLDATESLAVNVSSGALRVVAPLDREAHAAFNLTVYVQDVGGDTA
AATVLVTLLDVNDNNPRLPGGTTTPTYNVREDAEVGAVFASLGATDPDAGANGRVRYALA
TGEAPRFVSLLNDGSLALARGVDYEADATPDVFDVVLTDEGASPAPGAPVTITVTVDIVN
VNDEQPVIGVGAGGVLQASVYENTPVDTLVLQVNASDPDGAVVSPLSFSLESQPAVPFSI
DAATGHLRVAGQLDFEAVASPTFSATVVVSDGVHTVTAPVQITLLDRNDEAPQFVQPPLT
LSVYEDHAVGTNFTAPLVIVDADSPPFDAFVVQVLDDDTGAPSTVFAFANTSYALVLLAP
LDFSVRTSYDITLIATDSHDAALASSASVTVMVVDVNNNVPEPVMSSFAARVTENSEIGT
PITQLQATDADGGDNARVRFQLSADNQTNCLVQQGGESVLAVSIDTSGSVTVAADIDREE
QPTLQCTVVVADYGTPVSLSTTAVLRITVEDVNDSPPQLPAPGALIYNVSETASVGELIG
VITATDADAVASPVLYSLAGSSPPRFFALDAVSGRLTVAEEGLDVDVAAQYDVVVEARDQ
VMTSFVGTTTVRVVVKDANTLAPMLSGLSDVAYTENTPAIVVLPGVGVSDSDADFQVLQW
ATVALVGDSDGVGDGEQLGIAQAAVDAAAANSGVRVWFSDGNHTVSIAGEASLAVYEQLL
QAITYVDNADEPAAATRRVVVTVFDGLYTTSQNTTIVIDLVQDYPPLVLLDAAGSSINIT
ATVQEQQSPAALFSGAAIIDQDTGTWDITELRVAIEASSPPQTNALAVTCTSGVSCDSAQ
MQIVVTGAAGLAMYNQVLQSITFAPLDDAPVPVAVRITAFNAVGESQAAVLTVVVEPMND
APVATVAAASVTYNETESGLAPLAGLVLEDVDSATLSYARVWLNGRQNATETIAIDATPL
PAGVAVTQMGEDTLVVNGTASLADFTRVLESLVYAHSFDVPPTQPREIAVQVEDDQGAAS
AVARVSINFVGVNDLPVVDVGGAGTYAEEGEPAAVFPSGVGISDVDSSRLSSAVLQLLDA
RDGDDEALLLLPTQQAWQLLQAEGGAMSFSGNGTHAVRVSGIATLRQYELVLDGLFYVDG
AGELTDVDSGRALELSVTDAQGGRTRVDVHMQLQAVNDAPILTLAPRGAQPAFVEGGAPV
SLVNVSNLAFWDDSASVASIELVLAGILDAVTEEQLLSSGGGAARIYTLELSDGATVDDL
MQAIAGVTFEDSADEPQTGTRTVELRVRDEEGLISNAVCVGVSVSQVNDRTPALISDTTS
FSVAEEQDAGQLVGTAIFQDADREPFNTMTVRISNVRATSPLGVQVPLNGAEPFALAVTD
DDITADGARNVEVTLATQLSLDRETISTYRVTLIAEDQDGAASTTTFSVFVSDINDNAPV
FNAAQYSISVAEGVTRQPLLVMTVSDADSGTNRAISPAIPAATGNPNFPFTVQPFQAGGR
TIVYLNVDGSLTDFDTQQVWNFTLVATDRSGSAQGMSTSVPVIVSLTDVNDEPPRFANTS
IAVSVSEDVSTPTVIATLHVDDADVTPGFRDTALTVQSVDPVSGEGLFTVSSVTGEVMLV
GDGVDYEAQASYTIQVLASNTGNPALTDTATIAVSIGNVNDVTPSLVSLTETPVEENAGS
GVTVIRAVVSDQDPGPGGLVVPMDGTGLIIVAVDEQDTPPTGAVVAGTSAFSVTVNQTDA
ATFEVVVQTTESLDYEAASSYSLRILVQDTMTQPAIRSLTIDATVAVVNTNDFAPELDVP
GQVLAPVSELAQVGDVVDTIQAHDLDAVDTVLTFFDLVDRATGVAPPAFSLTADGRVVIA
GALDYETTQSYSLGFSISDDGSPQQVTTDLNVVVNVQDENDNAPNITRVEQRVTAVSENF
TALPADATSTPLLVAALVVQDADSAAVTQLSFTIVPVYQGFAAGAYFSVNSTGHVFLTAP
LDYEETGPSVTVQVRVRDSDDDASAHTVLVPITLAVTDINDNAPTLRSANGTQLLVRENA
GQWVLLTTFTSTDADSGPRGQVRFVLESASHPSLVSLNATTGELRVADVDYEQVQAITCS
VRAVDMGDPALQSPLLQLDIEVVNLNDNLPVLTPASVNASLIVPWDTRVGTLLAQLTAAD
ADVAGNNAVEFAVVGGSSGADNGGSAPLIVLQDGQVLFNVSGTSRVPTQRVVVEATDTEV
AGVRQSVQTTIELTVADVVAPMLRSSVAAFQGTPSRASLSISQALTSLSFSDTRAEVEAS
IGERSAALDVALPPLSSSSSPSSAPNASSSGSGNSTSASTEYVVVDLLQGEVWSTGDEIV
LFAHVRGPDGNPRAAVRSVRVVVHMPVTASTLDPSNFTAACNTSQETGSCLLRLTVPSSW
FSVVDAGSSESIRITAALQVTADAAAANSTDANTDTTATTWVEADPVYATLRQQASLSSV
KNNLVAVLPPEPQEPRTTLTIDVEAIFQVRVSSLQFRVAVDNANITDVAFDAQRWDQHTV
DTTSSQALFFLYASKRSNALPKNARRSVVQVTLDLPRGVAQDAVTLSITVQAATTLEGTA
AVPANTAGVLVDAEGASTEGRVRLFVDEPVRLLSFSPQHRLINTYSLTEDEVAVDLSHIV
VYVSGDVRTPSADDLQCSSSDATALATAASCESVLMDGSTTQPSAQVEVSITLVSEPQLA
TNLTFVVLAPAGDPRAVLSPSTTLRAVSFSACSSADGTLYQQGQLDVLVTFTDNADIEEE
LQITSLVADRLQVSNPDVLSVDEYGVVTASSDGIVSISLGPLEDFENSTAQVVTHLYLDD
GTWIAVPASASVVSHASLNEDVVVVSDDGVVVPSGVGEGDLLSVTFSPCPAVNYSTTADI
QVTLPEIASVELVLETTRLRVEGDNAAAVAGLSLNTTLRVLVTFVDGRTKDMTSNPQTQL
TLDNGLVLSADADAGQGVIVSVAPGASAGAYNVWVSFASLAGTASTTITVVQTTGLQVLA
TPYPRYAGSDAVSRTRLRPMGQSGVYQQAALGVQLLLSDDSTVDVTANNDTAVFLTNATT
GDRLAVSSVFSLNTDVNAGDGASSESFVLSASSTGAEQRVVIAATFSSASSPTLPAEQAL
VITAAAVNDAVAIAALDNLRAVAPGEGEGGVVDVDVVSGVRNTTAARVTCDVVFADGSRY
PSVVSPATGDVAVEGLVSFTSTTPSVLEVGASSGALTPLQNTRFSVCIVADALGVSSLVS
EAIGLTVNLQPDMGDVDFGQQSGLTFSGAVLAQEYGFAVRFNPSSQRLASLDMVVELPLT
LLTFERFVPATNVSVVSSAGSTDEHIFNLTVSSPAAAAAAAGDDGSVLLGTVVVVPKRTS
PTATVSGRVLSARDDSGSSIGAQPHPIIAGEAELPVSMSGGSSGAGDDPSTACSLYARRR
RRRDLVSDSELDHSEENDRNNDNDNADAHGVPVDDSDGAPGATIPSPAEVIHAGKRVRRN
TVKMDDCGSGGRPRGDVNGDCVFDGADGDLLMLYLVHAASGFTLEDSEMVRNAVVDSELD
VNRDGTVDTRDFIALQNFLNKRAEILTEAAVSTVDSPLTSCSLNITATLSGSNTRIDLFV
DLASNDPAFQQQFHDSTYMDPGTGEALVTVNRTAGPYGGLVRLAPAAGVNATFALTSASA
FNLTNIGVSFVQVSNQNESDPSQAFVTLHVGTSSSSSSSSSVVYEGDLLAVLPLTTSTNA
TVFVPSEYSPLHLVNNTLPTAYCVNDYTPEFSASAYAVNVSETLSDQVVLALSAVDADLG
DNGRVRYALVSGDPFGNFSIDPVSGELLVHSVDYEVQTAYTLEIAASDQGPDLQHTSTVT
VEVSVVDANDNSPVFANANPPGSNQFAFAVSENVTLPHLVGVVWATDDDSGANGRVSLAL
ETVPHTNASLFSLDTATGELWLVQNVDFEDTGASSLLVLVSATDAGVPTPRSVTASVRVY
VEDVNDNAPVFDEDAYAASLPETTPVGTPVLTVSATDLDVNDDIYFFLEPPSNPSHAGLF
SINATTGVLRVASELDYDVAGLRTVQLLVTASNSKAGQRPTLPVPVSITVTNVNDETPTW
DHPTTLVLDVSEDTAPGSVLVQVNATDADEGIAGIPRYFVRTISPTDAVEVSLDALFGVL
TLQSPLDREAVDTITITIGATDLGTPPIVAQDLTVVIAVQDVNEFPPVFSQATYALSVAE
RNTPAEESIGAVSVSDRDVGDNAAVGFSIVSGNSNGAFDVNATGHVLVVGTLDRETQAFY
RLVVRAENTASPFFSAQAVVTVNVTDINDNAPDFGQAQFTVEVSEAAAFNTMLALPTAVD
YDLGNASRVSYSIAQYELSRLPFLFNTTDRERPSLTLVTALDREANDTYTFSLVARDAGR
PQLSGAVLVSVRVTDVNDNRPLLVAEGSTNVTVPEDLAVGSVLAFGLAATDADEPNTANS
AVVVELLDPSELFRVHANGTVELVGALDYETTREHVLRVQAHDSGSPQLSSSVVTLRVLV
TNVRDVAPEFTQPLFECSLRENATLGSVCGSVVAMDVEQGDTVRYAFAPNFSSPVFAVNE
STGAVSLTAPLDRETTATYLLAFVASDDANLASTQPGFMRVTVQDVNDQVPVFTDDMYAC
SIYENASIGDACVRVLAVDGDEPGNANARVTYTLVSSNSTSFGVNATTGDIYVREPLNRD
RQEVAVMTVRARDNGSPPLEAPELATVRVQVLDVNTENPIFDQLNYTCAIRENLPAWQLC
TVVHADDADIGANAAVSYRLVLPSANRTSVVGGGGGEGDLALPFALNATSGQLTTTLELD
RETISNYTLYVEAFDAGIPPRASKNLARVSITVVDENDNSPQFAAASYACSLVENRTALQ
VCSPASASLRFWDVDQANTPNSEITVTFADARFSWNGTHVLFSPMSGPAGDGVLDREQEG
AFTVNITATDGGGRATTVPLYITVLDVNDEAPRAVSVPPCHVLERDGAGATGIAGGERLV
SCGRVVATDDDAANTPASALTYSIAGTTAPSEWGVGANPIVAINSSTGALVLNATLFDRE
VQSSFVVIVVVSDAGMPSLSTRIPVDVVLDDVNDNEPEFVLAGNATGEAPVYTCEIAEWD
ARINATASAAPPVECSAPVFARDADAGLNAVVRYALVNATGFPITSDEDENADTNTTTST
TTSPSLLFTVNATTGVVSTRGGASAALLNREQQPVFVVYVGAYDLGSPTSLSAAEPARVD
VVLTEVNEYAPEFDRELVEAGAVCYVPENSAGYQCPEPFAATDADSSDSPLGNVWYALEP
AADGSDALFAVDAATGVVSVADNGLNREARAAYNLTLRAEDGGGMFALLPVLIVVVDGND
ETPVFTTANASCTLWEDAAIGVYCDTVAAVDADATNNTVTYSVAAVVVLDPAADAPSVPV
STFAVDPSTGNVTVAGPLDYELYQQLAVVVRATDAGFPPRYSETRVTVTLLDRNDNAPAF
SASAFSCAIAENTTGACELTPPLQVTDADAPDTPASTVFFELEGSLASSFALNETTGAIT
LTRPLDRETIGNTVPLTLRATNTDLQQTSSVSVTVRLEDRNDQAPVLLNTPYACAVYEDA
SVGTECMLVQASDADEPNTVNSRITYTLTGSSLFAINASTGAVVVNGALDRETTPSLVLA
VTATDNGIPAMQASASIAVTILDVNDEAPVFSQPSGYACSFEENADGAGSLCTTVSATDR
DAGSNGAVSFALEDDMGGRFVVGETTGVITITRALDREVASDYTLRVVASDGGTVSMTAV
AEVQVTIQDQNDNAAEFELASYACDVPENAPSGYTCVTARASDIDQPGTPQSTVIYTLHG
AGATMFAIDNATGEITTTTPLDRETNASFALVVRARDATEPAPLTTEVALVVTVLDVNDN
APAFAAEEYECTYTEWPQTERESSSSGDGDTVFARCGPFVATDADAPETPASNVTYELIP
DTVDAADDDSALSAMDLFTVDATTGVVRPVPHVRFDREERASYSLVLVARDAGEPQLETS
ARITVTIDDINDNTPAFAADVLRFTFPETMAVGAVLTTLEATDADAGGNGQLAFYLVDDF
SNGTVQLASNGSLVLLRPLDYDVLSRFSLTVGVADSGAPRRFALATVEVAVQPFALAMNS
TSIWLDWSLYFDTPAEFIRNTLVRREAQQCNAGYPDESDGCNTRSVSIFTTRDVNRTTYV
DTGLKPATVYEYQLWTTTLTGGSSSTRWFARATLDGVPEAPATPVIVQVNETHVQVTWSR
PTASHGRIERFELVASAQLAANSAAATNSSSSSQNDGARRRRDVVSITPDQGDVVLYSGS
DETVVIGPFSADYVYSFYVVAYTSAGGTASPSTTFQPDPEFGM
Download sequence
Identical sequences PTSG_09971T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]