SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10095T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10095T0
Domain Number 1 Region: 501-661
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.37e-20
Family Growth factor receptor domain 0.0014
Further Details:      
 
Domain Number 2 Region: 277-413
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-19
Family Growth factor receptor domain 0.0009
Further Details:      
 
Weak hits

Sequence:  PTSG_10095T0
Domain Number - Region: 1153-1191
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000636
Family TNF receptor-like 0.0056
Further Details:      
 
Domain Number - Region: 705-738
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00337
Family TNF receptor-like 0.0054
Further Details:      
 
Domain Number - Region: 1462-1498
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00761
Family TNF receptor-like 0.0048
Further Details:      
 
Domain Number - Region: 1111-1155
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0118
Family TNF receptor-like 0.0061
Further Details:      
 
Domain Number - Region: 990-1026
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0137
Family TNF receptor-like 0.011
Further Details:      
 
Domain Number - Region: 657-783
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number - Region: 1355-1411
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0334
Family TNF receptor-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_10095T0
Sequence length 2461
Comment | PTSG_10095 | Salpingoeca rosetta conserved hypothetical protein (2462 aa)
Sequence
MQEFVRVEDSAVTSVTWTVPLSTPSGQYRITVTSIATTSIVGYIPATGTFTIKRRFRCIS
HDSCGPSEYCDIYGVCVPCNDCLRFVDAIDGECPFKCFETPPASFPEITFRSPTTSTVVS
AGSAITITWFFNQLVLDFIDLYIVPMGSSALDTAVIIRTSVAAGQYTWTVPSDMLSGDYW
IAAVFTDDAERTIIGHAPNSIEAGSVGFSIQGCPTCSDNEYLTGPCGGKVVPKCMPCTEC
SAGTYETRACTLTSNRACDACVRAEDCGSGEYLAGKCTATTSPKCQVCTTAKDCGLGEVL
LGTCGGASNPVCVACESPCRTCAGTTRTCKSCVANTYLSGSTCVDVCPEGMYGDVTSGTC
TTCAEECEACAGGTSQECTACAPGYFLSGTACVSVCPDGYYGDATSRVCVRCAVCREGTF
AVGGCSGVEDTLCQGWRVCASDEYEVRAPSATSDRECTACRTSCPAGKELAGICGGSDGT
RDRVCEDCGSGTFKASEGGEACSACRTVCADEHYLSGACTTTQEPVCERCIEQADCRAGQ
YAGGTCGGSDGRSNRECLACHGTCAECVGPTATDCTACSGDLHLDDGGACVSECDAGFFE
VGNECVPCDGSCLDCNGDGPGACTACAKGTFLHRGECVAVCPDETYGDVVQRQCQVCKVC
SGDEYVLSACGGTSNTQCSALSVCGAGQYEAVAATLTSDRECADCRTSCPAGEELSVACT
ATADAQCTPCVGGTYKASAGSGLCAACTRECGDGEYLSGVCSATTTPVCAACTSTCAAGQ
YLDGVCGGRSNPQCTACTECSAGTYETRACTLTSNRACDACVRAEDCGSGEYLAGKCTAT
TSPKCQVCTTAKDCGLGEVLLGTCGGASNPVCVACESPCRTCAGTTRTCKSCVANTYLSA
VRECTAGQEYETQAPTATSNRACAPLTTCDFETQFESQVPTATSNRVCTPLSSCDAETQY
ETQAPTQTSDRECEGLATCVAGEFVATQPTPTSNRVCASCPAGTTDHDSDSETACVACPA
GHFSSAGSIGPCSLYMCPAGTADTDSSASTPCEACDGTSSFQPAAGQASCLQVTTCVAGE
EEQDAPTAVSDRECRPCQLGVTYKAQPGQNTTCAAVRTCLAGEEQTLAPTLSSNRVCTTC
GPGTFKAAAGQATSCIATQNCAPGFQESVAPTPASDRQCEACPTGTFKSTTGQATCTAHA
TCDTDTQYQTKAPTTSTNRECGPLTDCGTGEWEERAPTATSDRVCELCDSCEDEGLTQAT
ACTETANTVCENCDTCNPGFFVSSPCTSVSQTECTECAECGADQYQTQECRVSTNTQCAP
LTTCTASQYETVAPTDTSDRECATLTTCVVGQYECVAPTETSNRQCCAIAQCDVGEEEAV
APTATSNRQCQNCTAGTTDDDANGATPCVQCPAGTFVPEGRTGDCSAYRCAPGTVDADQL
PSTPCTPCSSGVSFAPTSGLTACVAVSDCPAGEEESVQPTLSSDRVCTVCAAGTFKEDAG
QDDCMTASTCASGTQYVAQPHTPTSDTVCANVTQCTATQYQTVAPTAMSDRQCRNLTVCE
ANEYQTRAPTATTDRQCATVRAACSMDEFESAAPTATSDRECTQLTTCRAQQYEARAPTP
STDRECIYWTNCTAAQFQVTAPTSVSDRVCANLTVCTATQFEAVAPTTTTNRVCESCTAC
PGGTHYEMTPCTASADATCAMCSTCSGDTYASAACSETDDTTCTACTQCVDGSTFESSPC
LAHDDRVCLPCTVCNVTTEYVGRACNVTSDTQCLPYTTCAVDEYEHVAVTRTSDRQCLPL
SVCTEVQFISAVHTTTSNRVCQDVRSCVRELEYEAAAPTPTTDRVCEAVAVCVGDEIEVM
GPTSTSNRVCRLVDQAVGDRNKTSLVLPLVAAVIAALVIALLTSVGVPIKHSGPLPHVGM
KANPLYSGAAASGVHAGALSGALWLQRDNTITGTQETSVDDMRMVDIGLTGASTSDDQVP
DALSQREFLRVASKRRANGWFTLKRQRRAGTTAPAASRSASASAGTGLVKMGLLTGRDAQ
QGTRSSMRSSAHFLPGLSAWAREDTGIEAMLGAASNGGFERIPVASSTVSTTSGSAACSS
RISSSGASDVTSIHSGSRSGGSGSGSQESLDSNAWANGGHDNDELLTFDELAMFDHDAAD
NHTPGAANALAPSSHVPGTVSSGHEEADTDGDDDEVLSLGDLADMDDRGEPGTADGDLDE
PATWLPAATSADDKHTENMWDVASVGEGGDESSDDREYVEVDAMATSSSNAHAYAFATPT
NIPVANYMEVPDAAGLKGDDEYVYLGRDQLAQGGAQTEGNEYSRVYGTARETDVAADSDY
FEPRGGDDDYSHDGSAWRPGNDPVYGFVVGGCGSDAAGDGDDTDTETVTANSGQDSDDGD
PDDDDDDVLELSDLAMYDTLDVSTMASAQWLADGQDAGPSSTRDRRDRIEEQHIYDKLKR
R
Download sequence
Identical sequences PTSG_10095T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]