SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10105T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10105T0
Domain Number 1 Region: 442-753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-75
Family Protein kinases, catalytic subunit 0.000000545
Further Details:      
 
Domain Number 2 Region: 301-414
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.24e-26
Family cAMP-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 181-294
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-24
Family cAMP-binding domain 0.00093
Further Details:      
 
Weak hits

Sequence:  PTSG_10105T0
Domain Number - Region: 30-74
Classification Level Classification E-value
Superfamily Tropomyosin 0.036
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10105T0
Sequence length 760
Comment | PTSG_10105 | Salpingoeca rosetta predicted protein (761 aa)
Sequence
MGAAASQANGAVVNGATGTVSQPANYGLVAESRLLRLQKDLDAANHTIQSLRNKLAKAQT
DVGKFEKKQADLQLTNQLLLKEVDKLRCIADQHRRRDVSITAGAKAKEAGLDDDIVGHTP
PALGTDHMRPGAKDLPGGGGDDDMTAAASTEPAHHRRGVVALAPKKAEATSIPKTRVLDD
TTRALIMRALQANPYTSKLTLAQQREVAVHMSVQDIAPGEVVIQQGDVGECLYVIAAGIV
TVSTATSDVQNDIMAGTVIGELALLYDCTRTATITAKTKVKVFAIDRHTFKIVAREAKLK
ERERLLSLFQQMPLLRGLNDDYVLTIVDLAKEVAFDQGEAIVEEGQHGDVFYLITEGQVL
VTQDNIKLRTLRKGDHFGEGALLEAYNIRTATCKALTEVTCASLSREAFLKHIVPLEALG
RLSYLDVRQEEEESVKNECKEEFKHITLESLEQRRILGVGAFGRVTLVREAESDRMFALK
AIAKAHIIENGQEDYVVCEKRVMESLNTLFCAPLYRTFKDERYIFMLTEALLGGELWKHL
RAAGRFSDDAAKFYVACVVEAFSFLHNRSIVYRDLKPENIMMTSTGYVKLVDFGFARKLS
RGTKTWTFCGTPEYMAPEIVMNQGHDGGVDYWALGVLTYELLSGRTPFACNDDMDTYNLI
ILGIDHVRFDAAVSGDARDLILGFCRETASERTGCDKDGIKTIQRHRWFKDFNWPALETQ
TMPAPTVPTLDGPEDCRYFDEYTPREEPPVIGSCPWDADF
Download sequence
Identical sequences F2UPI0
XP_004989016.1.12839 PTSG_10105T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]