SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10108T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10108T0
Domain Number 1 Region: 672-830
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-20
Family Laminin G-like module 0.055
Further Details:      
 
Domain Number 2 Region: 425-629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-20
Family Pentraxin (pentaxin) 0.078
Further Details:      
 
Domain Number 3 Region: 1977-2026
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000257
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 4 Region: 892-1012
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000493
Family C-type lectin domain 0.01
Further Details:      
 
Domain Number 5 Region: 2028-2086
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000428
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 6 Region: 2188-2249,2539-2559
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000714
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 7 Region: 46-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000171
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 1909-1961
Classification Level Classification E-value
Superfamily Kringle-like 0.000006
Family Fibronectin type II module 0.0064
Further Details:      
 
Weak hits

Sequence:  PTSG_10108T0
Domain Number - Region: 104-132
Classification Level Classification E-value
Superfamily Kringle-like 0.0128
Family Fibronectin type II module 0.029
Further Details:      
 
Domain Number - Region: 2082-2111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0347
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10108T0
Sequence length 2773
Comment | PTSG_10108 | Salpingoeca rosetta Megf11 (2774 aa)
Sequence
MKTCQAWKAALGTDAKDGEYIIHSAAANGGCTPKQLRFALDTSRSSPCADSPCENGGTCV
PGEGGYTCLCSGPWEGNDCSIECEDGLCKDLPCTCEHGGVCSEDTCIEEDSMPPWCSLTK
HYDEDKQRGDCLIHASKPFVKPSPNTPPPSPPPPPQQGFGHQCLQANEGEEVVLSCAQDK
RLVIAAIQFASYGTPTGTCGDFKQGSCHEPTSAGVVEDRVFNRTCGWFGKHIAVQYKCGF
EVEGEWITVDDELLANVLEMKVITHAACGGSAPGVTIHSDVGVSMSGASSCGDPWWVLVE
MTLPFRVTGVSGTIEVTNSLDDTAQCDGDCWTANITSLLPSSSSPSSSSSSVAHVPAPGV
YFGTPTTALKRGGELYHVYFHRTWRLPTTFLDTPTSSLVIAVAATETAHPTLNFNLEVFQ
TAEAEQGVVATYSFDTPINTADSTIVPEEGRPQGVCAQCPTWEDTGISGGALRFDADKKQ
SIILGSTSALHMRPAWSVAMWVKPVYSNCNHDICDNEPLLCTEDSTSGRLCLLIDGNTKL
PVLDTLRWHVRGDRIVHEKQWTHLVFALSNTTATVWVDGYATTMDIMSVYDGRSRLLLGQ
DFTEYYSGHIDELIVFSRILTQSEVEALSGIEPTVLPRTLFDFSSQYQSASGLASITCVN
TTCPHIRWKDVGGLGVYFPPAPKSCLPVADVDALGVSFDKSFTVAAWINPDTTTSMLPLV
VFNSNPILGALAITSGFLQLLTSGSTFRHTAPIRARSWTHVALRVSTTAKAITLFVNGEG
QTMTRAPNLRAADVVRIGCGHDSFIGWMDDVAFYDHVLDDSDIRALASQLAPKGISAAGA
GCDFETSSCTWTGDAWTRRRGPMSDDANHGPVEDYMLQSLRTTDVQCAFNHHTFRIVDME
TQYTFDEAVKFATYMGGHLATIVTREEQLCVFGATSRPVYIGGQFDTDENTWKWIAGPES
GTNINKGFQNFAAQTAHPKPNLVMNFPGDAHGTWRGCDDRSCSFVRGFIVEFEQPTGQVY
AYDAAGNDTRTEWNDDTEFLNCFHDVGDIALLNSSVPSAVHRNTRVLAQHSVHVGTATPS
SRMTITATFIAVNQWGSNASVHMHVNDKEVWMWRPAVGDSEHKLPSYICDDEDGHYYHTS
GLKDRSLEVDVGAPGNGVLSIRLEGVGMGGDALLAMQQFTVDVERPGPAAVCMDGSREPC
YVAATVAPDTSTPILSSAFLAPPADTNACRHEGLRFWYNMRGEQWQSANTCSDFGWTVIN
DTTICSSSSIDGQCHDLSTYNTAASLCAGVGARLCTLDELRTAPADTDACGHEDARVWSS
TPCDEDRVVTAVVGTDSRAKAECSSILNLAAKVHCCADAAITGDPARLDVRVSSVQSTTK
KTTPKIVWAALGGSDEWVEATVSLKDLDDPLLPFQIEFFGDFVSGPDHAHSSAAVAVDSI
SFEGCEPSTNHGNEDDFQIYQLIRRGMLAFALTSGTWTTSGQSVHATTATAAAYAAVNDN
SDKKAADADASAYLQLGSQDFNAQVTITDLASSSISLVLNGGQLDGKMTFSASKATFSGD
LLGGAPTSVDVPSSLPPQFTLFVKRHGTALSFFLESTLLHSTDVGNLNLHHFGVVADKGV
SVTDASVALVFHEDDSTDDDTQPAEPVIEQTDIPVLASTDDAVEHHSQSTSNKRGIVGIR
FTHVPLSREDTVTNAYIQFTASATSGSAAPTLTIAAELSRTSISFENVLHGAPMKAEDSD
SAGGVKYFLSSLFSSSDACTFIGGTYEGGARNDDRLRVTKYWTASGELVAPTSPTQPVIR
YLECRLSDSVADHELSDRQRTTHAVAWQPNAWVKGDRGEDQQTPDLSPLINEVVQQWDWA
AGNAISIFIAGHSDAGSSRSAYAFDSGQKDFVPTLHIEYTSSAVAPEQDLEAICVFPFKF
NDKEYFACTEDANPLQLSGDTSRPWCGTAPVASERDFGFCTSHLVSTYGGNSNPGNYTAH
CAFPFVYQGRTYTDCVSFTASDGRDGDPWCSTTLNYDEDGLWGFCEIPTYGGTAGGAPCK
FPFYLSGKRYTECTTDGGRGADRAWCFTSDTTETDSAGAAWGYCTDGSETVSSWGFECTC
PPGFEGHSCAPGWTGPDCNTPDSSGGKFSCSLCINADPDWKCTESDTQCKCAAGWSLPYC
VEECARGMYGKNCQQHCGCKRDAVCDAITGECDCPPGYTSQSKCADPCAPGTFGEDCDEK
CDCNGHGTCHHVTGACTCTDGFTGEHCKEPPKRVSVFVNELHYDNAGEDAGEAIEIAGPA
GLSLAGWTVAVYSGTSSGAVHVKNVMVGKAVIPEMQGGMGVVKVSFPSNTLQNGGSYADG
FALIDDTNQVLQFLSYEGSFVASEGPAKGMKSEDIGVQERSGTPRGYSLQLTGVGSSYHD
FSWASRPLPNTFGAVNTNQRFTGGAALETLSFVYVIGAIIGAGEYSDRHISTLLSSGEDF
TLDVLDRVSTALRGVGVSNDDVSSVYIVQARGAGVSVHVTLQSADLPSSTLIVNKLSELR
TLSFGAETLAIQSVTEGDVCLQGTRRNPTTNKCEMAAATTTQHQTTTTTATTTTATSSSS
SNMRSTRSTTSSFVPSIETTPTTTAGDFSTTTTSTTSTTHHLHSTASAPPTSATATGPVT
SGAEPTETPAHAHHALSRAQRGGVMAAVIIGTIIVVLAIIAYLSKRADGSFCPRRSTRGY
ARMAAAEYLETDDDDVDVHEHRNRQSLTINNPVWEGPMADDSAGDGSVFEENDDTTNVHD
GHDDDSDDDTMLT
Download sequence
Identical sequences PTSG_10108T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]