SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10192T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10192T0
Domain Number 1 Region: 572-761
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.53e-19
Family YicI catalytic domain-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10192T0
Sequence length 1015
Comment | PTSG_10192 | Salpingoeca rosetta hypothetical protein (1016 aa)
Sequence
MAVGGGAGTRSSARCLWFVGMRVLVFALVVYLLAVLSTHMALHNTQSITGYSHMKRPADQ
LERLDEAVHFSDRDLHRVARTKDPPSPPSPPPPSEPSEPGEGGDHRNKDTSAPHDHGTRS
QHQQHQQQQQRMQRSDTNERNGGNAQQAVHDHDQQQEQQEQQQQQEQQQQEQQGKEQQEQ
QQQQEQQQPWQQQQDKESQEQRAQDEQTGASTANEVLLPFASIHARSLVVQGNGVALGLQ
VVPVNTDMGRAKFRRSQEHGGGEDQHAQQQQQQQQQQQQQQQQRGGNDIVRDEAHEGMNK
DEPQQQQQQQQQQQQQQPQPASLQLSFVDNTLTGQRIESKGLLFQVGLGDTTCSSLDCCA
LQRLTLTPMSNTHRPNEDTGGAAAPDARERESREDGAGDHHLQQHQAQPRQSQGEHAALT
YSDDAVWVSSASAVLLCRVDDATVFRVHWHSDIHDQPEHVARWSLQLEPITRALTPSYLI
TLAIRSGSVVGQGTVRGSPFVHRNALMFLSLEHPLSANGRLSSQPDMAVCGVLGLPRIAV
GATSRQYTSIAGAFTSCVRRVAAIGRELVAKRGVQLDSFLWDDGWDDTKSLWSFHAGFPN
GFTPVSAEAKRFNSGIGVWISPWGGYGEAKQERLAYGRKRGYEANEAGFSLSGPKYFERF
TAIALEMVTRFGVNMFKFDGISFGDGNINEFAAELEGMLAFLKRLRSASDSELWINLTTG
MWPSPFWLLYGDSIWRGFGDLGLHGDGSLRQQWITYRDAVVHKMVVSKSNMFPLSALMLH
GIVTGAVGEARHLHLNKVANIMHFKEEVWSYFAMGVQLQELYIRYGSHAQTHARMQSHAI
DVMRADRDLWPGFSAHDRNHMQRPDTMHAAAWDVVAAAAKWARARAPLLQHSRWVGGDAV
ELEVYGYGSWLDGDFVLFLRNPTNVTRPLELSLARALNLPSALSTAAFRATCRFSNFDDA
CDRIWQTVDRGDAQPCIDDDTDCVLSAAVKYRTHLPGLGVILIEGSQQKQPNLAP
Download sequence
Identical sequences PTSG_10192T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]