SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10194T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10194T0
Domain Number 1 Region: 117-199,269-340
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.67e-17
Family Asparaginyl hydroxylase-like 0.022
Further Details:      
 
Domain Number 2 Region: 790-852
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 968-1034
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 854-917
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000695
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 1169-1228
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000118
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 907-979
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000032
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 7 Region: 1025-1083
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000032
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 8 Region: 1053-1164,1196-1211
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000314
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_10194T0
Sequence length 3111
Comment | PTSG_10194 | Salpingoeca rosetta conserved hypothetical protein (3112 aa)
Sequence
MAATRLSNEQQQEDKQPSLAFHDFFPSTDTATFFDSIYQHDTFVDSQPHGNAPQLLSPTM
RDVVAPLADPHALCQHHFSLDEEQRKPKSKHTAPFQIKEQGETRQVSSCKQMEDELAAGA
GLLIRYEDLVDSPAQDHVKQLQDGVRDVFGTESTVHLYHATQNESRALMPHTDPYDVLVI
QLHGSKRWTTCIPDAYVSDTDTNNDGSGTNAEDDDNTNTGTGDHGASASASASASSSFPS
HHGTRARPSEAETIKHFNPAQLGQLQEIRRQKQEGCTRYEDRDLRGMRCTEFTLRAGDTM
YMPKGIIHFALSGEEGSSHLTISLERKGLAWADALMHAALSGSDIVDTRRSLVTGENTLQ
QHGDGSAAGGERDEVKAFVASFQSLCREVGPDVLETYTKANDLDAFLNADGIGALVERVC
SEESATAVVEQLCARGKMPVDVTSPRFRKMRVPQMARTRRNTVTTSYNCTSGCDENCNRF
TCQCDEGCTTTCNEGCTDCNESCDGVTQAVMQAATVDVMTAATSETYPVSAMEPVFSRTN
TSPCLRPADHPSSSAHVLTCDNDVAFLTMYSCNAQAATTTATTATPAVIPIAFQRTVTPT
ATEHVRAEGFTSCCVKDQDCDADCDGSCTPTSCDTSCDGPCNSGCSTTCNTGCDGCPDLS
SCTGSCDEGCSCNPGFAGSGQACEACPTGTYASSSGQSTCTPCSSCPSGQYRVNCGGSSA
GTCGACHACPPGEQRVGCEGTNAGTCAACPSGTYKSTQGNGACSSCPACDPGFTRVECQG
TSAGHCVGTTCDVPPSSSNTAVSVSNDGIYPSTATYTCSAGYELQGSNTLTCSVSGDWEG
DVPQCVGVECDGIHVDNGIVTPSGTINYPKVAAFSCSTGYVLMGATSAQCQADGTWSSPA
PTCVGRLCTLLDTPNHGSVSYTNNRQYPSTATYTCQAGYELSDTGDAQRSCIASSGGFGG
TAPSCVGVLCNPLGDPQNGHLRLSSTPARYPATAEFSCVPGYELVGQAQLSCKTDKTWSA
PAPTCRGVLCTAPSIDHAQVSATSGRYPADASVTCAPGYGLVGASTLSCRTDGTWGELPS
CQLCPANSYAPSPTQPCASCPSGTSTNGQTGATKCECIAGHEPSGDGSTCVPCQANHFKP
DFGSVSCQQCQSGFQTENGDFTRCVGVPCDPVRDIENGDPENTMMHRYPATVSYECDTGF
QLVGDVSSITCQTDGTWSALPSCTYICGDDLVVDGEECDDGGHNKTVGCSSTCQLERLHS
CVDGSTAACVYCNFTSRPERLVLACDDPMLDTKVQTWADATGNAEVLDHEHCGDPSLSYV
AGKPRGTVPGCYHKVYAFTAVFDGGQVMETVAGVVRVYDDTKPTFQDPPSSTTADCHSVP
AFADVSASDTCMTSSPAVSKQEVRTDGACPYAYTLTRTWTTQDACGNENAATQVVTVQDV
TKPTFTTRPTDRVLECSADVDADIEALRMKHVDAAASDLCSDTLSFETVETARDLSGCGS
TGQVSLKVTVTDECGNPQEETVTVDVVDKTAPVPVNVPADVTVECSAIPPIADDVHARDA
CGLRRVNATASEERQDGPCPHSYDLLRTFTFVDACDNPVSRTQRVTVQDTTGPVITRDAD
DLELECSAERNDATIAAWLAVNGGAQAMDACSGVHTLTWTHDYDPQYYEVFPGGCSVGTG
QVLVTFTVADECGRTSTVNGSIKIVDTREPAFVAPLPPLTGACDAVPQATVPQAYDNCTG
EVTPTQTTTRMDGDCPHQYHLIHSWVAEDECGWTTTTQQTVTVTDAAAPTITKQSADRTV
ECSVADNEAQLDAFLAEHGGAQATEVCGGVTWLYSDVDTVLDVAQGASGDVVKQDGCGTT
FAATAHFYAVDECSNAAKTTATFTVQDTLAPVLDTPPAASIDASCDAVPALRNISATDMC
AGALVAVASEERLDGRCTHTYTLSRTWMVQDPCGHMTTKSQLVHVDDSAEPVITKEAEDL
VVECNAETDSVIAAWLEAHGNAAAADACDRELTWQHDFESVKYLLQYGCGSNAVNVTFTV
MDDCGNAAETQARVVVQDTTAPFFTQLPSDDRAECDPTTNQNTLDVFLAAYGGARASDVC
GGVVGQDVAWSYAVDLQTVCGNAYDSVVTFTATDHCGNNVSATATMAFEDTQKPVIKLRG
ADPQLAQVGFPWLDPSVDLAADRCHQELTPFVEVVNPPNTTQVGNVTVFYRVEDACGYVG
LVNRTVYIRDTLPPTLEVLGAKRMYVSAGSLFLDPGAAATDAYSRGTDIVTHAFDGGVDI
GSVRNAALDGNRTSFTIVYRAADLSGNTVLRYGRHVRVLPPPSPLLPATAQVSLHFSRSI
VLSAEAGDDAPSSGEPTPSEGSPAFTYTRLVTPVADADSGSVTLSVFEAEGLSTLLGGEV
HGVQVEDPSTTLKEVAVVLGPVSPDVVASARASDAIEAMSTPVRVRSFHGSVRTASGQCS
GKSGVEDSLARVGRRLVSAQCDGCLCIFTTNDPARTLTSSVAFDAMALEQTVQHLVTVQS
STGSALNLVTLRLRLQQLGVVPVRLVHKNQGQAQVMFVARTPLPSHEDLDQIARVTLVSN
QPIVGTRITADIHSDTSNVTILSRLYALGIVPDSMQLVSSENGTSTTLTLTTNNDVTNRA
ERELADNTGWIHSLLSISYVYPGSIEEPLWPFNYTITGRSNVTQDDVRDAITTTLTHADA
VFVIRGCEARVCTVSTNTPLLHTTLQALRGQGAIFEAALTVDVSIESELISSLEENLSLL
LPYPANRISVFRSSAGPQHQQQRRKRELTDIAVTVSFTAQEDASLVTAVPEEGYEVPRSR
YLLRFRVKNAASSANAREKALVALNALSIAAVDVTAAGDQVTAVTVSYESDDRLDQFRAH
ANIISSSVLQQVSIDSPLSITDAVAATTDLANSGELYGVVHGRKLVVVSTTSTFNPNPTT
TTTTTNPSVTVQPGASTSGGEAWQISVGVIGALLLIVVLVAVILRHRRRQAKRTLANTTV
LQHRTVSYENPAYSGSMTTTENPYTMYDDLGTIGDAQSTDYAELPPPSVRNGRLLSNPLY
ESGPTLSDDGDGYLSVDGTGAESSPSAYEDDVDDGYMVVRGTGLDDGKTDA
Download sequence
Identical sequences PTSG_10194T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]