SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10215T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10215T0
Domain Number 1 Region: 995-1031,1113-1186,1555-1592,1646-1786
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.72e-75
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000769
Further Details:      
 
Domain Number 2 Region: 298-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000018
Family EGF-type module 0.0049
Further Details:      
 
Weak hits

Sequence:  PTSG_10215T0
Domain Number - Region: 948-1002
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0392
Family beta-sandwich domain of Sec23/24 0.023
Further Details:      
 
Domain Number - Region: 242-290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0494
Family Complement control module/SCR domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_10215T0
Sequence length 1790
Comment | PTSG_10215 | Salpingoeca rosetta conserved hypothetical protein (1791 aa)
Sequence
MTMMSVVGVSRSSVGAGVCVGVVVLVAVVAAVVSGDAGAGSGGIEVPELHVENGSVYLDV
NADRGVWVRRFNSDGSHNQSFALTDLTPQLLSVISQQQETIQQLSSAIDQLNSTKVSFHQ
LEIDLDAVTTNIDFARQAAEMNAANERSTLSTAIASSTSTTVASLSTAVDMALDTKANTR
EVENNLGDVVEHVTNLEEAVLDLQHTTGNHTDDIEALLECMRRGLVHDDVTGRCVPAFRH
DDCSAHIDPAGMSVDCTNGPIFDSVCTLVCPSGYDGGGKFRCNLTEGWEPYEEGASLCRD
VDECSLTPSPCMGTCTNTIGSFECSCPGGELAPNGRDCTQTTAIPRASHWDNQVYDQNTY
MNDIIVTQNGDNAGASYHGRSMGTEIIPIDQHRVLYCLSMGKSRGTDYVTLQVYGYLTGE
GIISTSQIRNARIASSGGFSQHSFGKPEFVPSHAYAILGAVTTFASTRRDHYSVSIGRSF
NPTYNSWDNEPFSTSTDSAAFANCEDTGHVHLTHNGDASGMDDYYGMSHGSVLFPTLSGG
GFKVLNNQGWNGGGTSYFTLQVNGYVPGGGYSNIKFFDPSDVKRLKFTVTNAPVKHTDIT
PPDTVPSTAKALITLLYTYQDRSNLEHMVHSFGRSASHRTDPWDNVVYAANTYLNDILIT
HEGAPSATWYYGFYHPTQVIPLKENGQFEAYLGMDKSGTQTHYITMFVHYDYKTWSATFA
AVKDPETMSSSNYYDTRPSLARPINNTSSHTAAAPPTRLYPLHRNTSSHASIHNASTTRG
SSSSKTRITAHSGTYLATNTSPLLRQRSSTTTRTSSPQSHVVGRASALPTGRHQLTSILP
SKGAGSRPSYRVPSQASPPSTSSLSSSASRHRLASHTRNAAPPAPASTAIKGRPTSPLGR
SVSRTTATATASATASTAATLATATAAGGSSNTNTTTASLPSSSSSSIHHQPSLPHHSQQ
QQQQQQQQQHHYDQQQHHDDGGVSAAGPGLNTAPVRGLRNIGNTCYLNSILQCLAHCQPF
HAAVASAASPAKDDDACGSSMHCGRGMTKYSLGTKPTTTAITNSPARVLVKEIKGLLADM
WADASRSDAHLSPSSSSSSASPQSQQSRHANAYYNYNNNSSSSSNNNSMGRRHASQRRTS
SFSTAIAPTRIKSHLGRVNPEFAGFRQQDAHEALQYLINALHDDINCPSLLVPQLSAVGR
CRGSDDGDGDDDVDDDGGLGSADDAEGDDDGDVFDGDSNVEHYSMTAPTPSNGEDGSRNN
KTQRLALTQPLPAGNTLSRAGAQKAKRDGRPTSNTRRQAGPRFRVQRWLSGRRERHSAEP
HRDPRQHQREPRHPSAPPLATMATAAAASRDDDEVDVGVSIDGDGAPTSPSPPLPPSSTS
TMSASASRPRPTTRRKAASTGTGSDTKQGSISRLRAVQRLLPRRSRPTSHSTSAAHAPAR
TAAAAAAAGVLASGNKAGAVGGSGGGERKRQRSQSRTPSGGAGASMGITHHSTHHPHRSD
GESGRRNAIMPTTQLTTLEQRRAYVKELRALMEAETRPTAKFRMCQQLADVFDRSSVYDA
LRGWLRVRRQCLVCNHTEVLFEHFLNLSLPIVANARAQHTYRPVSRRRVRGDDGNSGGGG
VTLPPLHDRPLSYKPSTSSQPSLLDCFAAFTATEELTGDNKIRCERCRCNQPSARSFSLH
RLPPILIVHLKRFEFIQHRSRKIDSPVHIPFTLDLAPFASESGEGHEYELCAATMHAGSV
HGGHYTALCRHPVSKQWFNCNDASISTIDTPSPSRLQHAYLLFYHRSRSM
Download sequence
Identical sequences PTSG_10215T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]