SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10237T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10237T0
Domain Number 1 Region: 10-144,350-606
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.4e-38
Family Amylase, catalytic domain 0.0093
Further Details:      
 
Domain Number 2 Region: 1019-1188
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.93e-26
Family CPF0428-like 0.069
Further Details:      
 
Domain Number 3 Region: 936-1022
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0000000000000646
Family Bacterial glucoamylase C-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_10237T0
Sequence length 1194
Comment | PTSG_10237 | Salpingoeca rosetta hypothetical protein (1195 aa)
Sequence
MMLGGKEVTIARLAIQTVLPTSLGPFEEWWERILVSAKTGFNTIHFCPLQEMGGSRSPYS
IRDQTKLEPSIFGSDAGKAKENLRDFLLRAGKPENKGGMGLFFIIDAVYNHTSKDTPWLL
DHPEACYSLTTAPHLQPAFVLDQAIWLFSKRVGAGAIEHKGRTVPADVKTEEDVHFVLDA
FFAHTHEALKLWEFFVVDVDAAIADMKTAFARAKPDSTGQPLDESLVHTRTGGGRFSARI
RADTCAAVLKGLGFRDQDKAAKELKSFLEEYNLKLYKQLDEDMAAARTAMKHTIVWERVN
PRGPQKGRITAQEPLVYLYFANVSKDRQDEWSDFATCPLTTVDPKYILACNGWVWNMDPA
KDFVSKEKRSYLRREVIIWGDSVKLRYGDSPDDNPWLWNHMCSYTRELASMFGGLRIDNC
HSTPKHVGQAMMDAARAVNPDILVLAELFTQSEETDIEYTNTLGITSLLLECMSTHSAGD
YSAMLHRYGGVPVGSFSALPHRPLPLVHTHPRATLLAASHDNEFPATKVWRSDLPLIALA
AMIHNGIGSTRCFEELLQQNLAVVNEKRKYRPWVEDAGKDSLEGVSDRTGIIAAVRRMNT
IHRQLAAKGFTEIYIDHIDAHCVSATRRNPDTLEEVTTFAYMVYRGHDISTGEKTIGPFK
RSGEISRVLLNAFPNAYHVEYTRCERAAVGGTVSYSIREDVDPAAVKSLLIGGGGADLWY
RLRMRPGEVICFEVTPDKSALDHHTAVARAIRTFGRPNAGDHDEGDDHAGALAAMTAVDM
NHALFRCIRENETAAYRGDGVYDVPGYGPLKYAGIAGVVPLIETVVSQNDLGHALCNNVR
AGDWLLGYIAAHMHKRAGTRFLGEALDGIIARYKHIPTNAKPEVFAQIVSHVYSALRRTA
VKRLLDTTTLTEGFGRDLAVAALQFYGTDAAFLMPEGGEVVSMSAGLPHFAAGWMRCWGR
DTFLALRGCLLIPKLFDEAKHLILAFARVVRHGLVPNLFDNGNNPRYNCRDATWFFLQSI
KDVVGSTHRYTDYQLRPNVAIAMTVAPDLFTPARANHHLDICDQFLVGGMGMRTLDPHDW
NYRPNYVNSYDGPDKAIAKGWNYHQGPEWLWPVGFHFRARLKFAKERGKAIHQANRYLAR
HEAHIQRTPWMGLPELFNENGSECPDSCPTQAWSIGCLIELLHDIHEQRSSISV
Download sequence
Identical sequences F2UQQ0
XP_004988576.1.12839 PTSG_10237T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]