SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10403T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10403T0
Domain Number 1 Region: 834-969
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.47e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 121-217,274-357
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.61e-18
Family Asparaginyl hydroxylase-like 0.031
Further Details:      
 
Weak hits

Sequence:  PTSG_10403T0
Domain Number - Region: 1391-1443
Classification Level Classification E-value
Superfamily Cupredoxins 0.000657
Family Plastocyanin/azurin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10403T0
Sequence length 3311
Comment | PTSG_10403 | Salpingoeca rosetta predicted protein (3312 aa)
Sequence
MRAARQRPRPLPAVFVACLLLCTLTTPLLAAATAAVVAPAVSTPELSLSDFFPSVEHGEF
FHNIYQTDTFVDHRPGGIANVSAPLRSLFAPLSDVDVLCQHFEAQSAVTSGFMQVKDEGE
TRQVTSCSHMREELAAGAGVLVRFEDMHTSPVQEQVEQLQAGVRRVFGMDSTVHVYHATQ
QDSRALQPHTDPYDVLVLQTSGSKRWTACVPSSAPESSSAANDDASSSSSSSSANASVAD
TDATAAATAQPKMTPAQLAQLQEIRQRRQQGCTRYSDADLSGMACTNFTLRAGDVMYMPK
GIIHFALANEEGSTHLTVSLERRGLSWADALVFGGTHAASIEDAEFAASWRHAVQALVDE
DAGVPFLEAVPTWQLNSGDGGLCAVALEGNATSAAAKEAFVTTYQDKCEALRPRLLQAYE
SVLDLSAFLNPDGVHMLVDRACSDDAAAAVLSHLCTSTNTTSSGHATTDALARRAARLPV
DVTSAEFRAQQAHNTPLSRVRRAAGLTCTGSCDGCSSVSCTGGCDTSCSYCNGHCRTSCA
CDDSCDSFSSSCDSSCACDASCDIGCRRCTGSCDDTCTYSGCTSSCDACEINSSTDMEFL
ESVVFSEDTVVTVKPNGCTYPRIIVRGNLTVTKFASIVAEPLPLACSTPAPSATASGQGA
AGGSFWTAGGNSAAVQASDPSQHLQSLSGGAAGGGDISGQGRGLGGGVLDIFVEEQFVLY
GQLLANGQDASTASAGGGSGGTIRIVCQEFLGGGSLSLVQANGGTGSTYGGAGAGGEVIV
EAAVRTYPSALIQAHGGLTRPDVQLHATASIGAVSASSWLPVTRDQLQCSTSVISNCNSY
SYSVDSTPGHLDDWARLYGGVSAGGGWSPNTNDADPYLQMNLGNVYVVSGVVTQGNELTR
YVVREFEVKYSLDCSTFTTYGEEGVTRTFLGSTSPTQKVFTRFRPVRARCIRIYPLGGTA
VGARMDVLGYAETPTSNNQLPVHPSPLFVNGCPESQLHHGTSSATITLDTPTAVDPSGAV
LPSTVAVWPQVGVSSPSMPATVGTGTHAFTFSASDGIYATDTCTTQVVVTPNMLTETSGL
CPADITITADVDRNDAVVSFTVQSGLSASIAPGSRFHLGVTKVFLYSASVYCSFTVTVNQ
RTRASGNGGPGIVYMISEKSLEIDAGRAFRQTSVAPADDHTAWLADYKDTAFLYDPAYWS
SKVDHLIIREGGLVVVEGGSATASFTSIDGQTGVFHVMESQKVEVLTLLDSRAIVGPRAE
LVLKGSGAVDVSGTLDVAGKLTVPNTPALSFSRMGSGVTLHATSPTTQLRTASLSLSDTK
FTVLRSSPTTAWTLASTLATSLVRSLLTIDGAVDFSAADVTVDSSSSLALDAQRSQPTTH
RIQWSPTAGWQDLNIHYGDTVEWVWQNEEHHITEQGGAFSSGASPTRSGVLRHTFNAIGM
FSFKDSALPATTSTVVVDFGFWSTPTTSVDLASLTVQASSHVRLGGCTFDVLAVTLASSS
SLRVDVNGTTKINTLSAADSTVYFYHPVSWYTAAGGRSQSITLSSPGSPGAVMYWDYVAY
LRDDGVFTDTSMVGIDFWTVGSGCTMYPGLTRVDLDFVDTLTINGRMDLTFNDYEEQVPV
QTLAVGGTSYINVPVTLHRLKDMSVGGLLVFDNIAHATSSDNSSVFDTTYVSTIGATIDD
VSITVSGTWQAGHVNVRAGSFRLTSGNAAVTMLVKDDLLRVDDLYSNGRLTVYNRVVFRA
QDGTSPMTSFAIGGSGAVSIDDDDDWLPAGSSLHADAVSSAGTFTARLLELVAASTSISG
GTTTMRAKNDIACTTTLSVGGRLFIDNQLTIRARDCTSNLTSASVGSSGVLTLDYVAQTS
NAPGVWSTATGSSLHTDLLSVSGTFRAGLVELEGGTLTVGTGGAITMEATADRVHFTRAT
IGGDVDIRNPVHVHARNKVDRMDFFTITASGSVTLDTVGHATGTKAWSQPTVSHVHTATM
RVDGVLSAGQYETYLEGTNDLVVGGTMTFDPPSLGHVIRYQTISVSGTLTVEKPINLTTT
HSLSITSSAGIITLDNERHTADDAPAWEAFPPSVLGSTIYTLDVSINGRFKAGYLWLRAD
SLSIGSTGVMTFDAANQQRAWVRSVNVAGTLSVLRPVRFRNQDGSSRMDGFSLTHSGTVT
LDVLGHNTPKHVWTGNTSSLIYTQSLIVAGRLNAGRLESIMPGVHTLEVRRTVVSPTSTV
NGVFTFDPVNIGDPALFYSVTVNGIMTVRRPVNFDITQTVSVGGTLTLDDDGHQGVPTVP
WDQYKESVIGRVVDDVTVSVSGRMDGGYLALRAAQVTVSGTLTFDAFDFQAHVDSMDVSG
EVSVRRQVRIRNQDRTSRATSLDVHHGGTMTLDSLGHATQDHTWTANASSLLHFESISVD
GRLDAGRLECVFPPVDTLTVGRTLVSSSPDSYDRGVFTFDPNFVSAPALFTSITVAGEMH
VRRPVNLNTTSTIDVSGLVVLDVDGHAASPRAWYAYEPSRIGTTVDNVYIRIKDGTFNAG
LFELRANLVELLPLPWTSGSSSGVHRRSKLTFDAFEHLARVDQWNITGTVEAWRHVNMRS
QNAGVMIGLTVDVGSTLNLDQVTRQAGATFTGESSMAINDFYVKGTYRAGKMAVANPVQP
WWTHMYVSGYFEFLPSRLYDINTCRIANNGRGHFATYGPAAGIAASGAGTGGSNAGRGGR
TPYTTAAAPVGTIYYRYAASTPPVENQMPSVWGSGGGLSGSGARGGGYIQAHVYGPSGTH
ITGTVRANADSAGGSGGGGAGGNIYLLTTSLTGSGRMQVIGGNGAGNGGGGSGGFIIAHY
ASGKWYSDQTDVQGGTGWENGGSGLAYLVGPNNFRNLRADNRGRSSRMQTDADHASVRQA
GAAAFLLPETETFNFEFEYVEVYGAAHLVFQHPTDDNSHARITATEVVGDRTGYLHILPN
QTLDITSVEPWKRYNISFMPQVYEHADLILPQRTVEWRCQNSPAYPSLSIPCTIRTWGFT
NMHRAHLLVSHGATWQWQLTSVRDLTCVGMTVQDTGTVDFLSAVADEADVSSRAVVSLEF
VVSDRLWLEGTISSNAGGSLASGGSVIVDVNYFEGFGHIQVHGGSGGAYGAGAGGRIAVH
YKRIHLFQGTFEAYGGTSDASTRNGGAGTVYLSDTSFGVVNRTLIVDAGNRDQGGLDMVP
DFDDISSDSGRTWLPALTAAKYDFEIVRILNKGELAMMPEMKQPYGLHVDRFEGDRTGVL
HTGEQQLMVGQFSELGEVRVNQYAYRYGHLELPKKFECFGITIRLLGFFGGVEDLTVGRG
CVLELSKFGTT
Download sequence
Identical sequences PTSG_10403T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]