SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10406T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10406T0
Domain Number 1 Region: 19-292
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000000000611
Family NagZ-like 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_10406T0
Domain Number - Region: 543-561,604-612,661-698,740-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000549
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 520-556
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0365
Family TNF receptor-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_10406T0
Sequence length 894
Comment | PTSG_10406 | Salpingoeca rosetta hypothetical protein (895 aa)
Sequence
MPSRSLGGHACLSAATRELPFCNTSLSIGARLDDLIGRLSLHEKAGLIGPDPVTSPCAFL
DNGVKRLDIPPYLYLVETNTAVASACIISQDKCATTFIGPTGLGAAFNRVISTEIRAFNN
LNWHRGGGILQDRTHRPTHSSSLHPPPFNLWDAFLSREYAAAYVAGCQDGPDRKYKKMTA
SLRHVDAHSVETNRMAFNGNISTFDLWDTEYKRGRLLPCARTPASTACPRRTLNGSADME
LGETYFTTNGYLAQAVKQTRTTMDTVNNAVRRVLKDSFITGQWHRREPNLPLRNGPCISE
CPDGDVCEEPFIETIPPTLTTDRLCSCDTLTCNKLITQLFEEMMDAYEARRCCPGCTDTC
ECSAGFILVYDADPADCRPCDSVTEFSTSIGGSKCEAIEECERGQEEVAAPTRCSLDRVC
RACPAGTIDSDSDGSTGCQMCPRWPLHGGGLPQLLLQLHLPRRHPPTTTTTATPPPRATT
SQSARPGLRRCRASHSSSVTVYATSARRARTRLSLASQGVSCLPVTTCAAGEEEIAEPTP
TSDHVCSQCELGATFKPVERPGRVMPPRHSVRTFPRTTASKCEFGTVQSQVPTLDSNREC
TLECSECPSGRFEIRACSALEHMHATRRRSASAPPVPPHFQVRPWRAARIRAPTSTSDTK
CEPCPIGTTDHDRNPLTACQPCSYGHYVPACPIGSCEQFLCQAGTTNLDRNANTRRVRRA
RLAWTLPPSLAQRDCTTVAECNLGYEEMVRPAMRPTIFTDRQCRRCIEGLFYRNSNTGFC
MRVCRPASLARICSPWTQFLSNEYELVAPSLVNDRECQRVRTRASTQRVHHRHRRLPQRG
VYALLFSRSVSGDVTVMGSTASPCEADVSWTTRPFGSSNNGRGGGARHGNSSDS
Download sequence
Identical sequences PTSG_10406T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]