SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10412T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10412T0
Domain Number 1 Region: 365-410
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000353
Family TNF receptor-like 0.0053
Further Details:      
 
Domain Number 2 Region: 260-315
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000221
Family TNF receptor-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_10412T0
Sequence length 603
Comment | PTSG_10412 | Salpingoeca rosetta predicted protein (604 aa)
Sequence
MAGECRAAAPTAPAAAAAPAAPTAEMHPHPRAHPRAHLRLPSRCAGTMVAMTVVLMVAVM
AGSRHQCAAQDFKPNFYCTDNPCNDVSYEVPGETGCPHTDHACLCVDEAFVEGFPAGCEC
RDGLTKTVDTSGTSPSGFVCGPCTVCDHFHFKASPCMPEQDTVCVNCATACEPGAYVDAC
GSSSVACEPCTSCEAQSRFEAAPCTSTSDTLCCDACADAEQFVAEPCMKTSAATCTACTR
CVDGLEFELRACGLTTDRVCQACTTTCAGPHEHVVTPCTPTSDAQCGCLPGYFESVPETP
TSSRECIPCPQGTTDHDRDGTTACMACPFAITNTTANTGSCEELQCAPGTAGSQSCQPCA
PPSHYQPLGGQTMCLNTTLCRPGFVEEQPPSPTTDRVCVACGHGTFSNVTADGAGSCVNW
RTCAVLTEQYILGDGTSSTDRVCAALTPCTPSQFEQQPPTRFHDRVCANISAPCDVGSTE
YEVLGILVYDGQAYELVCNTKTGDISLDGRAKNDNDRLQQMHTLLCDDDRDSYPDGHWIA
IEKTPGSNNFVARDCMTGNVDCCSRQLVDNFDTFPLRLRGCASINTGGGALVYSSSSTLR
IRI
Download sequence
Identical sequences F2UPL0
PTSG_10412T0 XP_004988793.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]