SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10414T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10414T0
Domain Number 1 Region: 1570-1828
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-71
Family Protein kinases, catalytic subunit 0.00000297
Further Details:      
 
Domain Number 2 Region: 2044-2121
Classification Level Classification E-value
Superfamily Cap-Gly domain 9.69e-19
Family Cap-Gly domain 0.001
Further Details:      
 
Domain Number 3 Region: 6-97
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000104
Family C-type lectin domain 0.0046
Further Details:      
 
Weak hits

Sequence:  PTSG_10414T0
Domain Number - Region: 441-517
Classification Level Classification E-value
Superfamily Cadherin-like 0.000733
Family Cadherin 0.0045
Further Details:      
 
Domain Number - Region: 148-188
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00965
Family TNF receptor-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_10414T0
Sequence length 2123
Comment | PTSG_10414 | Salpingoeca rosetta eph receptor (2124 aa)
Sequence
MYNRPRDLDEATFVARFSRHGPTDAIWLGLADVDGNGTYRWLSDGTQPQPYLFASGISAG
QCGAVSSAVTTNNKLVTLTCDTPLPALCTRPFQVCPIGTYRDFFTGNCTACDQGTYQDTP
AQYTCKSSKVFCLESGFGQSVPISATADRQCMQCEPGTHSTTTVLATTETIGVCASCNSG
TYQDQPGQSSCKPQPTCNPGTYILREGASYARECRACDGVREYQDEPNQHECKAVKLCTA
EEYEVEAPSPDSNRRCRSCELGVTFLDTAFQECRAVTACQAGTVEDEPPTLISDRSCRAE
TFTCKDGRENGDGDVCTCAIDNCQSCTKQPNSEEMYGAVLLQVNRHPQLSALVRPCQQLG
PQADYVASCASECRNSTTCTAFWIAVSEAEEGLCCIYSSFSSIGSYDRRGGSFYALSQCD
LCDEGHFKSGVGCRKLSVRPQVGMGVVDITLPLTATPGTRIGAVNATAEEGHGPLKFSLK
ETSDLFAVNGTTGAVMLLQSLTVASDISLTVLVTDTRDECFALNEDGTDVITNAGGCSTT
VKLAIKIAVFIGCPSHQSIYLQPELNEENVTWTPPRLPGFFSSLVVRNNTPALPVALGEG
VHTITYSAGPLNVGGYLLCEFDISLRYGFSILVESLGHVATGPLLQDFLLADNTIVDGVA
RPRRFRGDVVARPLAIGLVSKPGKPFTVFARNGVEGRIVVQLQWCTHGTLPATTSAFANG
SVAVTLLQPSSKATAAALVFTDHGSGVTQDARCLRIAVESSHIRGTLSFAGIDMTFTHTS
MANRTRRSSSPAPPSVTIRDYSPHGRNFVAVQFGNGDGSPLAEDSGPFLSQEDTIAPRWL
NCPTAPIVAHAQPGQATAVATWEELVPVDNVEVVDVQSSHTSGDYFSVVHSPHTVTFTAS
DGQLSTTCAFDVEVTFDPITTAVVATTSAEFSVSHEVLPLLHTQTYTHYLVGGTNDTALA
TFRLDAKLVTAIKFVVLPPPGERFFVRTVPTADRGQLVVDLVFSLASTSPIDADALIYDD
DAIVAYELGEFALDTTPAADGLDDNEQQDSLSPTGTITGARVHIDAAGGVVVVRGTAPDT
FKRGFSFASLTLQVSFPLGRNFTSLADGSAAIDTGETSTTAVPPPPANTTAATTTTATLL
NGTTMASAVTAPPTTAPAATGGGVHANATTSTTQPTSTAATTGGGGSDGNDDTGDGVFVT
KPFAMQAGSFLGFKLSFAVDDADDHSGFLSLLDTQAPFFRRCPFSLHRDIDVVLATVPRE
PHAIANWTLPVVDDNRGRDQLTLTSNVPAGGVFALQAPGDAPYSVQYDVKDLTGNTATCD
FFVAVRDFEAPRVVVVDDVVVTLPSAPYSPGHAVLATVTPEQVRAATNTTDNSGAFTWTA
PATALSLGTGETDVMVEAEDEWGNKGSAVVRVRVLDTTPPTLFCNDPSPVVTPGVQAEAA
VVNFTAPSYVDNVPTAATLTYSHAPGSLFPVGTTHVNVTATDASGNAALCVLAVEVIPFQ
AATAPDNSNIVAGASGGGAFLLVLLAVFAALYYRQRRRSRRPQNWDEIFEMIEQFKGRKD
GSDGPVVPRELNRANIKLLEELGKGAFGIVYKGLLTEAPIPGYLVACKSLHAKATASERI
ELMEEAAVVAQFDHPNVLQLIGVVSVGKPVLVVLEFMEYGSLRSYVQDNDVDEATRLLFA
GDCAEGLNHVHSKGFVHRDIAARNILVSSERRCKVADFGLARDTEESDYYRSRGGQLPVR
WSAPEALEDRKFTRATDVWSFGILCHEIWTRGKMPYDGWGNQKVWVMVCDGYRLPKAETC
RDVVYEQLLACWHAEAERRPSLADLAAFFRDEYEAYTGESLQPKDEYLAIGDTPHSGTKK
PRRSLSGTLGTFLGGLRRRSSKDGNLVINPLYHDDEMADLAEDESEDREALQLYDMGDNG
DDAAVCAGSERNGDAGRGEAMQLYDMGDGDGDDGAVARTEFTTNATSSRSQSDGDSDGEA
EEQQGDDNADDTVTFTLDELEAVDDDTAFGFGDVNTDTDFAEDDCLQLYGNVDTQQPCTS
DHGEGTCAITSKDLGRRVRVQGYECLGTIAFVGKHHAKGSDRVGVALDLPHGRNNGTVGG
VTYFSCESNKGILCVPTKVSLVD
Download sequence
Identical sequences PTSG_10414T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]