SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10482T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10482T0
Domain Number 1 Region: 1267-1477
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.17e-19
Family Trypanosoma sialidase, C-terminal domain 0.028
Further Details:      
 
Domain Number 2 Region: 1778-1929
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.22e-19
Family Growth factor receptor domain 0.00085
Further Details:      
 
Domain Number 3 Region: 55-249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000145
Family Galectin (animal S-lectin) 0.074
Further Details:      
 
Domain Number 4 Region: 1107-1225
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000992
Family APC10-like 0.035
Further Details:      
 
Domain Number 5 Region: 1928-2098
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000471
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 6 Region: 797-870
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000168
Family C-type lectin domain 0.013
Further Details:      
 
Domain Number 7 Region: 1624-1665
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000235
Family TNF receptor-like 0.0064
Further Details:      
 
Domain Number 8 Region: 307-431
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000068
Family CBM4/9 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_10482T0
Domain Number - Region: 1479-1521
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000647
Family TNF receptor-like 0.0048
Further Details:      
 
Domain Number - Region: 1668-1705
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000989
Family TNF receptor-like 0.0065
Further Details:      
 
Domain Number - Region: 2254-2285
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00265
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number - Region: 1588-1624
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0414
Family TNF receptor-like 0.0052
Further Details:      
 
Domain Number - Region: 2112-2152
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0989
Family TNF receptor-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_10482T0
Sequence length 2721
Comment | PTSG_10482 | Salpingoeca rosetta conserved hypothetical protein (2722 aa)
Sequence
MRGRVQQPLLLLLLQIAVIAVAAAACCVPGVQALGTKGPSPAVAFMFNTGSDTDAITGLG
GTYSGQAQLGHGGIHFTASGEDYFTSDVLPFDMPAEKTLEVWVRLDDLNQRAGGALSVQS
ADGSRYDGIVYAELAPFIWETGSEWGERSLDAGEVPSPPERAAAGAHVHIVATYSADGYI
TIYRNGRVYVPRYRKAPAAAFDKSDARITLGARHVQFGQQVWGQLKGHVECARVYTSTLT
QEQIQQSFSTRCHRVNPFDFVEAGTFEGLAPTNVTSTPAVTPWSKVSPFGKWSALWTDGS
AGLPALVVNTPAQFAQGVTAAALHVPCSSPGFSGIKQTIATEPGHRYSLSFIAAVDAADM
STSIQSAFQQYAIVTAGSMRQVFRPTYSAVGGRASWSRFRFTFDATDTTTHVAFHAEQAN
CIMVDNVRVVQVFDGDNLVLDGGFEEAAVELGVPYESLDATDASSDATPGQALAHWTVSP
SSGSKPAVLRPSIPFGTSSWALSLHGQACTASQFAEVFQVIPTMPGATYAVSFGIMNRRV
VDNMSANTSTASISVSFGSLSQAQFFTRRGQAHGHFTTRATATTHATTLRLAAPASSCVL
VDYVHIRPLTAAPVNMVSGGDFEVPALPIGDDGTTRQQQQETTSPLPPDSQWSSDRGVIT
GPTSSGGGAAVGAQNYRLQQLCTTAGTIKQVLPTVAGVHYQLSFFARANAAAQLDVVSGT
VAFASLVDTFTLESPRLSASAYSDWVPFSFTVVADEDSESIVFHAQAQHCIELDGISVFP
IAPRNLSVPDAAGYPVYVSTASAVTFAELEDACAALNAVPAVITNDADFEAAADACASFC
YVAYTRASANNEWMWAGDDDNTYTNWAYGDNTQFDVDDLVAAVAAGRSGLVPAGDGDNAI
AGLCTRYTDFRAWAGVWSVVFGSRALTTDIAIDGSARVCAITSGSGGTQDQTCTNAAISL
VRVDGFNDYYRIEQTGGTAAEAEERIELSADGTTLTYHTLNTTTGRFVEHGVGTRVLTCP
GTIDNLDPNAVASCPLNVQPSAPTAACRAMCKNGFIASTNTSTRFTCTSKQGSSMEEVAF
WSGNLECVSTFEEVQNVTIPFATSAATDIDNLVDGDTASFWQSRSNAFESSLFFDLSAPT
TVRRIRIYTMLQAGEDSATNAIPRTIRVDAASNIRYPFDTHVATLELDPITGWQAFDVAT
KTQFIRLKLTDTRNDAFVRVHEVKFDRARDGRAADPVIPPRNPDIPQISFCSSSSERNAS
LAVRDGVTAGLVLHLTFDDDTCPYVDRVSAQRARTLGPVDRTAASKIGTHAAVLDGQSSL
VLNRPDVYVTAHAIALWIRLAAPPTSTPQFIAGDWPLSGDADTLQFANLFLRENELRETS
TLNQAASVSWEAGRWYHIVSQRGPYDKSLFVDGERVAFDQTGVDVPGLRDAFWIGSRGAV
FKGTRANDRFFTGSVDDVRLYDRTLAPSEIKRIFNAGYCSPGSYFDPAKGCQGHTECKPG
TVETTPPTATSDRVCAPCPAGSLPGNNTCVPCTAGAYVPAGRTGACADFACKPGTVDADA
DPATACEPCDGRAEHQPLPGQMSCTPHRTCDVGQEPDATRPANAIDDTTCKPCSVGTFKN
VTGNSECVLASFCPPGTSVQAQPTASSDRTCAKCQPYTYSDTANAERCDEVSTCTPGTHE
TTTPTFTSDRECTPCEGGTFSNDQTAFECKACPTTCPGGHVLQSPCLSTEVGRGQSSFCT
RCPQGTYRGADDEPTMCFEVTRCGQWQFEAKAATFSSDAVCTNCTTCSPGQYVFSQCGGQ
TDTQCRGCTCPDGFYLAEDCDPTSTRPPACRSCDPSCATCSQAGSCDTCAGALVKQPDGT
CSDDCNTDEFRPSPTADCTACHSSCASCFGADDSQCLTCDAGKYLSEGSCVASCGNGARP
VNGVCVPCDECKDGFFLQQCTSNPDDDCARVTTCAAGTEFTAAPATATKDTTCTTCKTCD
PGTYRVVGTCEGSTDSICLQCDGITSYQDEPNQPRCKPMTSCPPGTHAERGTPSTDNTCT
ECTAGTTDHDYNPLTACVPCTPGTYVPANSTGPCSLLVCPAGTADDDRDPSTPCVACGDI
GMNMYQPSTGQTTCLQADPCKPGTRELIASTHTSAPTCVQCTVGYDYQDKAGQTSCKPVT
RCSDGEYEETAPTATSDRVCKNGNPCNLNSQYLLRPGTPTSEPVCAQLTVCTPPIEFEAA
PPTPTSNRRCDRVSFCSEGTYEQRPPTATTDRVCQPLPSCPPGEGVVSNTNPTCTPCEPG
TFSADRSATLCQLCPPNTFAADPAQAHCRDSTICLANQIETRPASPTADRMCAYNVDLVL
VAADNSIFTGGDDVDTNAVKSAVVSVVSRSGNARGVDAEAFDTTIVPALTVRFLTQSESN
AHQLRLWADSGALGVVYTDVYYTLRVNGSGDPFQPTTTPAPTTTGFYNSELSSSGCLPCP
TNTFASSPATVVCEKTSTCSRSEFELRPPTPTSDRVCEFGIGTIAYLLPALKEFHPGLRD
LAVFESAVRSGVVEPNAAKKRYPPASIKIGISEFEDGHVVVSFDSLSASNLASLSTAFYR
GFVDMKLRGHNIRLALIGFNVTEPTQPSTTSAATTAPQGTTRGASSSNSTGGLNSTTLGV
LIAVIVIVILCVVVVSVMFFRRGRTETATVNPYHSSFVNPIYDTAPNAPATDFFDPGEMM
DDPATYTDIPNIEGRDGQCSA
Download sequence
Identical sequences PTSG_10482T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]