SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10501T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10501T0
Domain Number 1 Region: 6-50
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000824
Family TNF receptor-like 0.0058
Further Details:      
 
Domain Number 2 Region: 89-132
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000414
Family TNF receptor-like 0.0043
Further Details:      
 
Weak hits

Sequence:  PTSG_10501T0
Domain Number - Region: 49-86
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00612
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10501T0
Sequence length 139
Comment | PTSG_10501 | Salpingoeca rosetta predicted protein (140 aa)
Sequence
MNILEHYYDACVAWQTCPPGTRITAQGTATSNTECTACEDGSFQPMANQTECNNWRTCGI
GHKWVSGTPIKDATCELCDVGKFMPRPIHQYRQCNAWSRCHPGTYESAAPTATQDRVCTD
CGLGNFTAQYNQKGEMRGE
Download sequence
Identical sequences PTSG_10501T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]