SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10516T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10516T0
Domain Number 1 Region: 39-86
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000144
Family TNF receptor-like 0.0047
Further Details:      
 
Weak hits

Sequence:  PTSG_10516T0
Domain Number - Region: 193-219
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0141
Family TNF receptor-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10516T0
Sequence length 953
Comment | PTSG_10516 | Salpingoeca rosetta hypothetical protein (954 aa)
Sequence
MACPFAITNTTANAGPCEELQCAPGTSGSQSCQPCAPPSHYQPLGGQTMCLNTTLCRPGF
VEEQPPTPTTDRVCVACGHGTFSNVTADGAGSCVNWRTCAVLTEQYILGDGTSSTDRACA
ALTPCTPSQFEQQPPTRFHDRVCANISAPCDVGSTEYEAAQSTATSDRVCRPIRHCNVTQ
FELASPASTSNRQCQACRACAGDEVEVRPCTLTQDRACEELRIVLLRPDNGSTIPSNRFV
VEANANGQFVPPVGQLQPSLPPNTSIVFVQPAMSTTNSISIAFPSADQTIAYAVMRDGVP
VVQRTVIIVVVDTTPPFFVFMPPALVLEAATLPRPATLVSNIAVHDAVDGDITPLPTAIR
VDTSGVVLDEPGQYSALYWSDVTDAAGNALPPTPRTVIVADTMPPVLAAVFAGVPFAWNT
TVMHEGATPFPYPTVTATDALDGAIPPASINRTDTPVAVAAAGPAGASVRVSYSVRDAAG
NTAVEGFTVIIVDTTPPVIETPRTGQRVHVLFGSDAVRRVRVDIRAVDAVDGDVSSLAVV
VLPTSPPIDTHVPGAHPVRIRARDNSGNTQAVGITLVIDPLVPPARKRRVLVVAVETRPR
APLQMLERELEQTLDLNANTAVILSATDPATTAASSDISDASINSSGKTGLSAGSVLFEV
GVRMNAMSAAWRDLQFLRDRLRNLHTLNGTRVLFSRVGNMTTYPSQPPSSSSSSSSSQSA
AVIAGTAGALAFVCIVTTVVIGLRRRMAGAKSTVHTLPPSPTAAATTTTPTAAEGVVGSS
VCRLERNPAYEESSITMNFNPLYMPTHVMGQEAMIDESSSDAEPHYNTLRLPTRTHTAKT
NSVQYDTLGASRTTAANCADDDEDGNYIEVSQGVEGDDEAEEVVGFAIPGTADVNQEQPV
YTDMTPASLSGLDAAGEYVVPATSADISGVCILDNTARYHATKHDGGRQTLQR
Download sequence
Identical sequences PTSG_10516T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]