SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10526T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10526T0
Domain Number 1 Region: 621-773
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.66e-22
Family Growth factor receptor domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1153-1249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000016
Family Growth factor receptor domain 0.0014
Further Details:      
 
Domain Number 3 Region: 444-486
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000589
Family TNF receptor-like 0.006
Further Details:      
 
Domain Number 4 Region: 1089-1127
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000538
Family TNF receptor-like 0.0044
Further Details:      
 
Domain Number 5 Region: 830-872
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000235
Family TNF receptor-like 0.0056
Further Details:      
 
Domain Number 6 Region: 1504-1542
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000432
Family TNF receptor-like 0.0038
Further Details:      
 
Domain Number 7 Region: 949-1000
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000636
Family TNF receptor-like 0.0052
Further Details:      
 
Domain Number 8 Region: 1665-1710
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000639
Family TNF receptor-like 0.0042
Further Details:      
 
Weak hits

Sequence:  PTSG_10526T0
Domain Number - Region: 536-570
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000349
Family TNF receptor-like 0.0057
Further Details:      
 
Domain Number - Region: 390-443
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000471
Family TNF receptor-like 0.007
Further Details:      
 
Domain Number - Region: 206-256
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00245
Family TNF receptor-like 0.0087
Further Details:      
 
Domain Number - Region: 905-1091
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00785
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 189-319
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0141
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 1541-1585
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0177
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 1770-1806
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0406
Family TNF receptor-like 0.01
Further Details:      
 
Domain Number - Region: 492-528
Classification Level Classification E-value
Superfamily TNF receptor-like 0.041
Family TNF receptor-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10526T0
Sequence length 1938
Comment | PTSG_10526 | Salpingoeca rosetta p75 neurotrophin receptor b (1939 aa)
Sequence
MAIFLSLLTVASVLLVATGQPSGFHGWANNFGGYLSFTCPSNQVLDGWYGVFSNSRLNSI
TYRSFGGYENSYYGGFTKTYPNGQAIYRIQAGHSDGYRDRRWRIGCADHTNNNGPYHSSC
SWSGWTNNWPSYYPYYYWFPFYYYFYYFYSPFYYYHYPTTSFTANSKYVIHGVQSDFSYT
FRDRRWRFYQCRVSCRSGWVQSGTECTCPSGSYQRGNDCVSSRKCGRGQYAASSSNNRYC
YDCRPGTFQSDSSHTDTTCSSCPAGKFQDDYGRADCETCPSSQYNPYTGRSSCRDCSSGY
YRSSPSTQTRCQPGYRCPGSCSRIACSPGTYQNSYRQVSCKSCEAGKYQTESGASSCNNC
ANGYYTTSAASAPRRCQPGFACSSCNRRACNGEFYQNAAGESDCKRASQCGAGQYVSRGP
SQTTDRVCGSCSLGRTYQDASSHTFGSCKPVRNCPAGTFVAADPTLSSDRVCGKCQEGTY
SSGVNAKQCEDIGTCDAGEYAFFASSTSGVDCRACALGSTYQDETNHNRQSCKTVSPECP
AGQFQAVAPTRSNDRVCNDCHPGTFSDRPGGDECDPHTQCGAGFIETSPATPTSDRACRR
CNGVTQYQDELHQASCKTVRTCSSTQYETTAPSPSNNRVCASCTTSCPSGKVLVGTCGPT
TDKRCESCHPSCATCDGTTENDCLSCADSSLTLLDGRCVNPDCGEGEYRDGATCKPCDSS
CAECDGAGSNRCISCKGDRYLDGNSCVTKCPTGYFKFTNSERDNVCRRCTSCDDGTFAST
PCDGSTFTDTQCSPWSTCDEGEEEDTPPNSVRDRVCRKCEADKEYQDQPGKLFCKSVSVC
QHGQYVSTEPTLTTDRQCSACGTGTFTNSENAARCLPCAAGSFQDETNSPSCQECGIGMY
EPEQGQTQCAEIPPGYYGVGGTISTRTGIAECPRGYYCLGGSHDKQACPPNQYQSETGQS
QCVDLTVCGDGELVSKEPTSISDRECSPCPDGTYQDDNDHDMTECIPWTTCPVGTHISTT
GNARRDQSCASCDAPETFQDKENQRTCRPVSDCPVGTAELVGPTPTSDRKCRACQVGTNY
ADDTGLEICKPVTNCRPGTREVAAPTASSDRVCQACEPNTYTESENEKTCRPHTLCGASE
KEVEEPTTSSNRRCGCTGPAIDECTACGPNLQLRNGRCISECPDGEYELGNGCAECHSTC
ADCDGPDATNCLLCDGNLNLWVDEQGQSCIADCPPGYYAKDHRCVPCTSCGMGTWASTPC
SASSDAVCSPWTECKPGQKDVCEEPFIETIPPTLTTDRLCSCDTLTCNKFITQLFEEMVC
AEPTDKQFDVVLDVCCSGQGEDGIRDTIRQMDAYEARRSCPGCTDTCECSAGFILVFDAD
SADCRPCDGVTEFSPSIGGSKCEPIEECERGQEEVSAPTCCSSDRVCRDCLAGTIDKDSA
GSTGCQMCPAGHYTEAGFHGSCSSFTCRAGTHDHDSDAATPCQPCVFGITYQDEEGQTTC
KDVTECAPGFEEVQAMTLISDRVCDECPEGTYKAISGQGVPCLPVTTCDAGDEETAEPTP
TSDRVCSQCELGATFKPVDGQAESCRPVTQCGPDEEEIREPTRQHDRLCRKCVQDITYRP
AGSDTCVPVSRCAASEYNSTHATLTTDVECTAVSNSQPDDGVRAHRLCHLISKCDPGEQR
IRAPTSTSDAKCEPCPIGTTDHDRNPLTACQPCPYGHYVPTGSIGSCEQFLCPAGTADLD
RNASTPCTPCQAGVDFAALSGQRDCTPVTECDLSCHQGVRPTMHPTIFTDRQCRRCIEGL
FYRDSNMDFCTRESSMRSCQDTECEVSAPTATTDRLWATISTCPMEQFEVLPPTTTSDRA
CAPAYSVSLIFDAKFNALAGTQSRREAFEAALVQSINTTQDASQIHSAHRPAPGLHHCYH
PLPERGHYGVPLQPVRLL
Download sequence
Identical sequences PTSG_10526T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]