SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10568T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10568T0
Domain Number 1 Region: 15-157
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000337
Family C-type lectin domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_10568T0
Sequence length 746
Comment | PTSG_10568 | Salpingoeca rosetta predicted protein (747 aa)
Sequence
MVVTTTTADTAPDDATCKDGAKLFRDDANEIVGCYKSFSRALTWTQAKALCEQATGFAGE
LAPARSEAEQSFLLGIAPREFWIGANSLEADGIWRWAGLSMAVAFDAAWVNVESRDWNER
QNQVIRVVEDRDTGNVTWYYATPNLETFPVVCRKQACGPNEDIVGGICSPNAPTVSSSSG
PRAWIAAAVLIPLIVVAAAGIVMYAYKYNPDLYDRIVDAVCCRTCTCAWLDDTGADPHTH
VEELMIENEKLRSQLASARASSQWNGNGLELAGNGSRPESRTSMGSFKPASLGLAPGMMM
ANSNVLNNNNNSNNNAIGSHDDIGGGSLIHSNGAVMSPLSSPRKGSGVASGAAVVPFEKI
AEASETSHQQLTAAANSSDANGFNSNTDDNNTVDNNNSNNNNNNSTGHAFATTPGGGVGG
TALGPKRSFGDRLKDSRRAPNARIRIRPLNTANTSTSTTGGGGGAVDGTKNNAGSTSGNN
SSDNDSSNGTTNASRGVRVPVVRGGLPPRRVPSVAGAVGRIALPNRLPNNRTGNSSGGSG
GGGVVLPARTVPSRTRVTAPLPVVTANRGEVVSRSGAHATVDEEKKEKVEDEGKEEEGKG
DNDRKQMADEDGQGSRVAVQSQPTSSRKAGSNSGDESGDEGDKKSVEQEQQEEEKEEEDV
GGADDEENGSRGGDGDDDDDDGDDDDGGGDGVEEIHLDQPQRRRSSTGIRAKLPNLRKLS
AVVTPAPTSDVSSVTPIQTSYGGHWL
Download sequence
Identical sequences F2URQ8
PTSG_10568T0 XP_004988103.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]