SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10574T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10574T0
Domain Number 1 Region: 103-358
Classification Level Classification E-value
Superfamily NHL repeat 0.00000235
Family NHL repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10574T0
Sequence length 405
Comment | PTSG_10574 | Salpingoeca rosetta conserved hypothetical protein (406 aa)
Sequence
MADEQGNVHLNTTSSGVSPAARGQAPKVVLNGVDVVGQLSSMARQTQALQRYCALRPHAV
DTTSIAGLTGTRKWQGGVLVPRNNSNTGSTTNSGTAGTTSRSGHGTIYAIPNLADQVLII
DTRTRTVDTTSITGINAVVGPVGGGKWTGGVLARNGLIYCTPTGAAAVLIINPTTNTIDL
TSIANLPSVPNKWVKGALLPNGLIYAPPADVDSMLIIDPQSNTADLTSISSLPSGEKKWT
DIVLAGNGMLYCIPGAATSVLIVDPSTNAFNHTTIGGFSTTIWKWVGGVLAGNGKVYGIP
YNHRGVLVIDPATNTADTTALGTHAGMLPLWAGGVLSEDKSTIYGVPFSSTSVLLIDTLR
NTTDTTTLAGLSDQEWKWSFGVLAGNTVFGIPFQADHALIIPSLC
Download sequence
Identical sequences F2URR4
PTSG_10574T0 XP_004988109.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]