SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10603T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10603T0
Domain Number 1 Region: 422-483
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00052
Further Details:      
 
Domain Number 2 Region: 5-48
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000117
Family Protein kinases, catalytic subunit 0.0032
Further Details:      
 
Weak hits

Sequence:  PTSG_10603T0
Domain Number - Region: 195-416
Classification Level Classification E-value
Superfamily Tropomyosin 0.00379
Family Tropomyosin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_10603T0
Sequence length 491
Comment | PTSG_10603 | Salpingoeca rosetta conserved hypothetical protein (492 aa)
Sequence
MTSVSLTAGVGTPLYMAPEALTGDKYSFEADVFSFGVLMWEVATQRVPDLIEQELGAEYT
GPILATLSGLMADGKRLKFEDGGDEGGQKEGDFLRPAALTDQNATLREVNKKYQRQIEEL
SAEVDALKSELASSQATIASLRDSKEALADAVAAAKKDADTTHMQCTQKLAAAEQDMAAE
RKTYDESRSSLNAMMDALQKQLDTERELREEVENDRAFSKQQQQEAEEKAKEAEQQMAAQ
EETVVHLRKQLKEVKGLNLKMLTNLQELQGQVKDEQNKCHAIQQEKDKKAAEIQTLQSKL
RDAVARRDHMEAALTEVGTRLKAADGKRVEMETALTVERQWRQSLQQEADRAAEKLEEME
MVRSQLVSTQDELRSLQTKHDMLQQSYRDQEKALLEMGERLSETALQVDRFEAQEKRNRQ
KQWADDSEIKHCQACERSFGVKRRKHHCRGCGGIFCDECSDNRMPLPSYAKPVRVCDTCE
KDIIAKMTAPH
Download sequence
Identical sequences F2URU5
XP_004988140.1.12839 PTSG_10603T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]