SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10665T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10665T0
Domain Number 1 Region: 306-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 2 Region: 245-311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000219
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Weak hits

Sequence:  PTSG_10665T0
Domain Number - Region: 399-435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0532
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10665T0
Sequence length 2355
Comment | PTSG_10665 | Salpingoeca rosetta hypothetical protein (2356 aa)
Sequence
MRLTDTLRGAQNKAAVSRRCLALALLLFVFSSMPEVNAEWSTISEPFTLTCPEGQGVTTV
SSEFNEDEGDRIFSLTCSDIGGQPQPPPTWTADYVNEFVSNDYDLYSFPPRDLTFTCPTN
EYLTGIESDAREARIQASRGRENFFADRRWKFQCAKLNGGTLMNCAFGQDETWYRDPFDV
SAPSSSVITGVSADVGAFFADKGEVSACLYLFSFTSGTDIDPLWSFQKCQITCDETSGYQ
LVGRTCQLRTCDPLVLPNGVTEGNCTGAFGDECKYKECNRGYELTAFGSITRTCDSIGTE
VAWTGTPKECTDADECATGEQDCFPGSVCVNTIGSYSCSCLFGEQRDDSCFVEAPTITVE
LGLTDMDISVDGEWGDTFPKYRVSVARWSYDLAAKEDIAGFPKTVSKPFTGYHVSNLAAG
TRYRVTLTPVGNNDEEIPYFSQVAMTPEGNDPQTICGCIPADPSGAPTDFQIKQFKGHVL
FRWADQSQCESAFSFTRNGVGLTSRFPVTEQLACGAIQEPNTVYDDLTIQSAGDYAEVDE
ALNYLLPEGEFYLRRFLAVDTGDTRFMYPHELQRQKTHFSSTSTTTTAAPQGVPDDEHRY
YPGTSSPVASVSECKDLCDIRSDWCIAFVVQTKSDDTLVCHQLRVIETATLRAGEKKAVS
FERVTVTGTGVDGSYIFDGTQDDCEEACSAHGSCDMTMVAAGVCAVVVDAVETETPLTQS
VHPDIDPTFSRRIPGPEPGTTQEYCIEANKPEWYDLQGYSSDPTCSDFTIMWESQLEGQI
TIDSKEIHLPVEGVEVEFEIGGLVRGRRITNEDGKFFIHILSDKLVGSRHRMTLRFSKTT
GNIKHTFTCGGIACTESTLIMEHLRFDHQVNVKDTTSLPFSGIVSIGGTEHEGLPDGCPL
KDVEVCLYDRNQANTLINCDMSDSKGRYLISAVLGTSVTVSLSFGNSSHTFERAPYKKDA
ANAPSGILQSIDATNSLVRTPYYDVTDGMFWENINFKDTTSDRGTVDIAGGLCNLNLGDA
VMEFRYDACPTWVKTHTISDRLSKWTLPAQIITVRFKEITRNYEVRGEITRYFSAKLGNS
RSLYLDLRNPQEDDEDKKTVRFEYHPPPQLSVEFDREMKHNCNSTEGDRPLHVMRQNEEL
KATVKVIEDYGEGVGTCDAVPGQIEVENQLGESPAIVDVLNATTSLTNKQLNKLKLCYDT
CLMDVTMDEELQDGETVYSNTRIELSIMTGEPETNPQAVDPENPYSKLFRVTMHNLPQDP
VTVYEKVVVVGDKVISKFFSVPFPRYQPLAVVQDPPGGLSTVTYSKAYSNYFMKSHTHEE
YHGFYFTTGLAPVKVETGVQQCVGLGAAVCTTVADTESTPFKITVDQTHTFGSMDPEDNY
GSERVWSFAIELTTSDDPGTAGEKSDMFLVPALNVVWLETEEVSFDVEQCQASKETKVKW
SLEGQDNRKVLSWVSALEIENKELPDLRKLLALAEQPPGDDDDDTEEDRAEKIAELKRAI
KAWEDNLDRNKEVRQQAADGLLEPVQSMWAKGNAEFECSPSISPDEDPDKAAKIQSELSR
TQLCSGFDVDRIADKAQKGISLAPHDDIDNGKDLDGFAASDQDKQDLRNIDTIKFSGGGS
TYTFEYDLSRGDSVIGGSSRTHEVSVGVDVEFGFKVFGVGMAFELSTGYNYEGTTADEYE
AGVSTDGALSVTLGDPDPYDVFDVGIFVHPDYGTFVFATFSGQSSCPHEPNTVKLEQPGI
SILKRPEAPVLPGEPAVFELLLKNDGPSSADFSLFYVSRLNQDGLEVVVNGQALETPLVY
ETFPANSASHVTVTVNQGPNVFKYDPVAVGWRSICETTNVEYVYLEAEFLQPCSPVKLVG
EIGESGAFTLNQETMEQDYKPGQIRVVAFNPDHARRTWLEDDRLEKVVIEYKPANSYIWL
LARDENGDALDIRERENEYGYITAWWDASTLLEGDYHLRIRAQCQASINEMPDGIDEKLS
SVATGVVDRDPPVVYGFPEPADGEFFPGDEMSFQFNEDVECRQPFIFQVSLTVEDYDRDF
NNNNMVIVCEGRKISMSLRRGFRYDEVNGLSANLAIANVKDLSGNTMQSPSQHTFTFAEL
NLADASVTVSGLVVNVPYQDVYADTTSEGFIDLADVLQAELATIVDTDPSRVTITGIAPV
DATDYTVGITVSLRFTPETADTAAAGRRRRATTTTTATDLATLLQSRLQDAAYTESLSVL
NTASLNEAATVELEPSATDAAQNGASGSSGGSAASVSTSTSSSSSSSTTSTWNDLSLAVA
SLALNAVQLVVVVVVFARMFVYMKKLGRNGRDDDDDSIGRRPSRSDPSKTAWFKAWSPRS
SKVQPFPEDAAETTV
Download sequence
Identical sequences PTSG_10665T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]