SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10853T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10853T0
Domain Number 1 Region: 25-225
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.32e-42
Family 1,4-beta-N-acetylmuraminidase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_10853T0
Sequence length 226
Comment | PTSG_10853 | Salpingoeca rosetta predicted protein (227 aa)
Sequence
MKLAVVLVLVVALASSSTFFLCHAHKGVDVSQATYENNWKCLKSHDYKFAIIRCYESVGR
VDSNCPHTVYNAWDGGMDAVSLYFFPDPRADNPAHQINSMVEYLAKFNIKPGDKKPHTYG
MLWLDIEGPQYWTSSKEKNREFFKGLVERAKHHGIKVGVYTSESQWSPIMGDWHGGSDLP
LWYAHYDGKASFSDFRPFGGWHKPSMKQYAGNINVCGAGVDENWHP
Download sequence
Identical sequences F2URK2
XP_004988233.1.12839 PTSG_10853T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]