SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10931T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10931T0
Domain Number 1 Region: 156-363
Classification Level Classification E-value
Superfamily vWA-like 1.45e-52
Family Integrin A (or I) domain 0.00056
Further Details:      
 
Domain Number 2 Region: 571-704
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-22
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 3 Region: 21-159
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.0000000942
Family Hedgehog (development protein), N-terminal signaling domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_10931T0
Sequence length 706
Comment | PTSG_10931 | Salpingoeca rosetta conserved hypothetical protein (707 aa)
Sequence
MRFLAATIVATALLATMASALSPGQTSPSNTDEADVSGVAVDYIDIGSAAYEALNNFDTF
VGTSHGIVFDKESHKLMTQYMAQLLQALDNAIGEDIAVVRGFQSRPQVPTSAPSLLDVGR
ALRLRYKADGSASSDARLSTLAQACINAGFDFVAVPADTTTDNYVYVSTPKMDCGDAVAD
LLFILDGSGSVGSGNFQTMLNFAQEVVSFFDVAPDKTRVAAMVYDSSNYRKFDFDYIQSV
SKQQLINYFDTFAYPDGGTETGSALSFALSSMFVTSRGARDLSEGVPRVAIVITDGKSGD
DVSAPAQALRDAGVTLYAVGISGADVSELNQIASPPVEDNVVFIDTFSEFSALASKISRA
NCDQPASVSSDIDIEVNNTSPGDIRYYRPDLDGLTESVLIVVETTGGATDLYVSTNPNPG
PFNYDYAVENDDAIKAVLVDNTGNEDYYVSVRSRSDDPADTVSYRVIITNAIFQGNASYT
IYVSTDENVAGTPIFTLPPLRSFDVVPSFMFDLFGPDEDKFVLVNDSEVVLTAPLEFGKR
HVVAIEGIDEANNLAGGIALNVIYNEMPWTASPDNGHEYQINYLKKLNWFDAKEACEANN
AQLASVSSVQENNWLAELALNTTLGSGLHQAWLGGHFPPVFAWTDGSAATDFGFPWSVED
NDPHAHCRFNCLALKFKDKKTTPASEWKDLRCGRKRAYICKRPIAA
Download sequence
Identical sequences F2URF2
XP_004988317.1.12839 PTSG_10931T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]