SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11016T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11016T0
Domain Number 1 Region: 306-584
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-51
Family Sulfatase-modifying factor-like 0.0022
Further Details:      
 
Domain Number 2 Region: 654-845
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.42e-27
Family UbiE/COQ5-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11016T0
Sequence length 868
Comment | PTSG_11016 | Salpingoeca rosetta generic methyltransferase (869 aa)
Sequence
MAVLSARLLHSGGLSVARVPAAVGAMLRGRHAAAQHRAARVFARALSVSTDEDTQGHQDV
VDSWRVNISGDPNKFVGPRPESWWTGKPPVHGTCPGVNSDGIIRSLPQPDLSNVTRQQLR
DYFDNCWTMTEVLFSALQTEEPFYRPPYHNLRHPKIFYYAHPASVYVNKCRVAGLISKPI
NEYYEHIFETGVDEMQWDDLSKNDMRWPTVDEVKAYRQEVYNTVVDIIENHPAFETIDQL
EASPFWAVVMGTEHEKIHLETSSVLMRELPLELVRPPEHFPAIHPSAREHGVTPDQEPVA
GKDYPVNQFIEVEAGSVKLGKPRDFPSYGWDNEYGEKHMNVKSFKATKYLISNGEFLQFV
KSGGYLDENVWEPEGWKWRCFRNVKWPTFWVPTGPSGLHQYRLRTAFEVVDMPWSWPANV
NYHEAKAFANWKSDMEGRDRTQGYRIMTEAEHHRIRDDYMSDESLGVARDPGMVADGHEM
ADKYGFNLNLAHGSESPVDALKPTSLGFHDVFGSVWNWCEDHISALPNFKIHPYYNDFTL
PCFDGQHNLILGGSFISCGDEASSFARFHFRPHFFQHAGFRLVLPNQTDPALVTSCMDNQ
GPYVGTNPFRSSRRDETERKYQAEEVLRQYVHLHYADDANVPEAARGYTDKVTQLLVDAA
REHGVATDRVLDIGCGVGGTTFALARAFESVLGVDISASFIDAAQQLKEEGSLPYFIREE
GDIKEEAVVGLPQGVDPARVEFKQMDAMCIPPDTGSFSAVLAANVLDRLSSPGTLLSRLG
GARGLVRPGGILVLSSPYTWMEQYTPKDLWIGGHETPEGNVRSLDGLKAALGENFELLRT
TQVPLAIREHARKFEYVISEATVWRHRS
Download sequence
Identical sequences F2USG2
PTSG_11016T0 XP_004987940.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]