SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11026T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_11026T0
Domain Number - Region: 43-141
Classification Level Classification E-value
Superfamily EF-hand 0.000156
Family Penta-EF-hand proteins 0.036
Further Details:      
 
Domain Number - Region: 268-344
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.0089
Further Details:      
 
Domain Number - Region: 573-616
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0194
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_11026T0
Sequence length 927
Comment | PTSG_11026 | Salpingoeca rosetta hypothetical protein (928 aa)
Sequence
MSRHSSTKRADLEVYVSEGEPQHNVHLPETFEPRRLKADGSHPAAPSKQKSQRKDDALRA
LFNSVSTKDGKRVYADGLRVIISKLMCATPISTFFGASPREVSEEHAYRVMSFLDRRSAG
HLTMEDFCEALDVCVRDDGQPSKFHHSLLMADALALHEHNLDLEEEVESLKETHAAEKAK
LTKQVDSLRQELLDLEQQNTDVLDEADTEMNNLQRQNMFLKTELVRARSHQNLADQLAPD
DGENDMSVCSFDRRDSAESIGVVSQTSELDALRDEIATLTEQLAQLSDELVEEKSRSTDL
QDQLLAASEALQRAEHKNTLAETQLSSLTADLNRVTAELKDLKARPSRTSLDISGMNYAM
ALGIELQVEAMRTENSNLKKENTDLKQRLLEHEATAQEKQKELEATVAKLRAQMVEMEKR
HAVEAEATQDEVNVRLSRKNEELREQLKTQAKEATARQRDMELRVKMLREQLAQTEKQLK
QADASASTIKLEVQSLRARLRAREDAGTQIATLQQELKTATADKHKLSSCVEQLHAKLRN
AEFEQTKQAQHIQALEADQRAQTRELERLRRQSSRWGDQQQQQRHHHQQEAREHEQIQRT
PNPRWPARQQQQQQQHGSVGEPVYDQGRKGRRGRISLVAGKSTADVRERSAVDTPLRGGG
MVRADDNDGRGGHGTGIGGDTKLTEEMLKLREDNLRLQDVVTALKRVQTDLMGEVSRLRK
LLSMHTNLQEQPKQLLKLDDVLESVSKIRQQQRTAALEQMEDLAAINRTLQGAYARSRMA
SQSFTADRFASSSETDVYSTESNSPTADAASVYGGDLYGGLVRETGFQLSPAHADPVSFD
VVCHPSTAAYTFGLQGPCRLVLSENDVRIQHMSTRRQHAWPWHSIARLVRDEAYVSLLVD
GVDGRELELLMYSDEADRIAKTFSLFV
Download sequence
Identical sequences F2USH2
XP_004987950.1.12839 PTSG_11026T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]