SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11044T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11044T0
Domain Number 1 Region: 45-225
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000039
Family NagZ-like 0.021
Further Details:      
 
Domain Number 2 Region: 664-718
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000942
Family TNF receptor-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_11044T0
Sequence length 991
Comment | PTSG_11044 | Salpingoeca rosetta predicted protein (992 aa)
Sequence
MSGAANRMNIIQASCSGTPVPTVFRKRPVSSALTVTSPCAVVDYGVKRLDIPPYLHLVET
NTAVASACSSQDTCATTFIGPTGLGAAFNRHIHGDARLQQSQLTQGGSVSQKIGLTDPFL
SGEYATAYVTGCQDGPNKKYKKMAAGLRHIDAYSVETNRMAFNGNIFTFDLWDTETLNGG
ADMELGETHFTKNDYLGQAVKHNRTTINTVHNAVRRVLKDSFIAGQCIVIASHAMFPSTL
TPSLSRHRRVHGLWAQVSPDGEYELGNGCAECHSTRVPGATPPDATNCLSLCDGNLPSRA
LPIALSTGYYAKDHRCVPGTTCGMGTWASIPCSASSDAVCSPWTECKPGQKEYVSGNAYQ
PLPERASCFPTSVCEEPFIETIPPTLTTDCLCSCDTLTCSKLITQLFEEMVCAEPTDEQL
DVVLDVCCSGQGEDGIRDTIRQMDANEARRSCPGCADTCECSAGFILVYEADSADCQPCD
GVTEFSPSIGGSKCEPIEECERGQEEVSAPTCCSLDRVDGSMSCQMCPAGHYTEAGCHGS
CSSFTCRAGTHHHHDSDSPDPVRGRHRVRGGLEEVQAMTFLISDRACDECPEGTYKAVSG
QPGRALPPCHHLQHTFPRTAVSECEFGTFQSQVPTLDSNRECTLECSECPSGRYEIRACS
TLENCNPSTEYERRLCHLITKCDPGEQRIRAPTSTSDTKCEPCLIGSTDHDRNPLTACQP
WPYGHYVPAGSIGSCEQFLCPAGTADVDRRNASTRCARRARLAWTLPPSLASTPCTLVTE
CDLGCHEVVRPTMRPTIFTDRQCRRCIEGLFYRDSNTDFCTRVSPCEPGSTTGICSPWTQ
FLSNEYELVAPSLVNDRECQRVRSCQDTEYEWSSLRCFHRACVPAYSVSLVFDAEFNALV
GTQSGREAFEVALGTTIATVASLNEDFTARLFRWSTSGDITVMGFTASPCEADALWTTRR
VGCTAGIIIAPVVIECYQHMPPSPPTSSSSS
Download sequence
Identical sequences PTSG_11044T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]