SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11048T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11048T0
Domain Number 1 Region: 90-320
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000284
Family NagZ-like 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_11048T0
Domain Number - Region: 624-663
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0235
Family TNF receptor-like 0.011
Further Details:      
 
Domain Number - Region: 652-688
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0647
Family TNF receptor-like 0.0096
Further Details:      
 
Domain Number - Region: 368-413
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0765
Family TNF receptor-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11048T0
Sequence length 755
Comment | PTSG_11048 | Salpingoeca rosetta predicted protein (756 aa)
Sequence
MRATAVTALLWVGGSALCASSKLKSNAPTSKIKTSVTREACATLCYTFKNVSPQAPLSTA
TNASSANTQAEFHRAVPAAHACLSAATKELPFCNTSLSIGARLDDLIGRLSLQEKAGLIG
PDPVTSPCAFLNYGRQEVGKDIQHPRSDLLDIPPYLYLVETNTAVAFACIISQDMCATTF
IGPTGLAAAFNRVISTEIRAFNNLNWHRSGGVLKKIVLAGLRHIDAYSVETSHMAFNGNI
STFDLWDTELLNDVVRRQWKRDMVMIGTDCGAIRKHGQRQQTLNGGSDTELKETYCTTNG
YLEQAVQHNRMTINTVNNAASMSARPADATLTSNNGRCISECPDGGHELGNACAEYHFTR
APSSCIAHCPLNYYAKDHRCVPCTTCGMGTWASTPCSASSDAVCSPWTECKPGQKESVSG
NAYQPLPDRASCLPTSACEEPFIETIPPTLTTDCLCSCDTLTCNKLITQLFEEMVCADPT
DEQLDVVLDVLLQPGEDGIRDTICQMDADEARRSCTGCTDTCECSAGFILVYDADSADCR
PCDGVTEFSASIGGSKCGPVEECERGQEEISAPTHYSSDRVRRDCPAGAIDSDSDGSTAT
LPPRARTSRSARPGFEEVQAMTLLISDRVCDECPEGTYKAVSGQPGRALPPRHHCSECPS
GRYEIHACSALEDVQCAGCSACPPNTYILRACDSENDVSRQQCSTCSDEQYRSAPCTATS
DDTGCTTLDVCDQDQFSSLSCSPPPRLPRTTTAAT
Download sequence
Identical sequences PTSG_11048T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]