SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11057T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11057T0
Domain Number 1 Region: 247-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000489
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 186-252
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  PTSG_11057T0
Domain Number - Region: 899-955
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_11057T0
Sequence length 2348
Comment | PTSG_11057 | Salpingoeca rosetta predicted protein (2349 aa)
Sequence
MLVRVLAVVVACVVSTTLAELPFVNEYHETLNMECTGSTGIKSLYSTHQDNKKDRRWGFE
CLKYGAPEEGTSMYSSSFENNYDDPLDYSCPNNYYVYRMYSEYDGNPDDRVWKIGCRKAV
GATLSSCSFTDDYINSWGKPIDYSVDRLYSVHNDRDEDRRWRIRTCTLDCDESSGYIEDD
TSDWGCTVVTCPPLTLTNGVLSGSCDGDFGDQCSFSSCNSGYEVSASGTKGARQCGIVSK
NGVWSGSAPTCDDINECVTGAHECVAPAVCVNDDGSYHCECDYGPLSSDGKSCDLAGPKA
TYTLNSHSFELAITDADEFPTYEVTVAQWSLDLSQATELPGYPVQYTSPLTNFEASDLQP
GRRFQVTITPYDSDDAAATDYVFVGGTSAGDLRTTCGCLSGDTTGAPSSLELSQERGIVE
FTFTDQSYCESGFNFFRDGISMSSSYDVTSEVECGTTHNPQLVYDDLTLQKEDIYKPLDE
GTNHDLPEGTFFLLLHTGSSEGDKRFAFPWELAIGEHFTSTSTSSSTSQSTSTSTSTSTQ
TTTTTTTTTQATTTTLNLATLNDTFIASTTSTLPATTTTTVADDSDASADAATAPSTGRV
ERVYPSGIESAVTSKQECFDLCEDRSEWCIAFVVQEDLSGQLWCHQLKLIRTTKLDGNDV
SADSYERVTVSDTGVSGSYLLATGIDACTELCSESSSCEIVFAGDGFCAMANTMQTTSVS
PSSYHESLIIRSQKHRYVGSAPGSYKQYCVAATNPIDYTALGYYSTRTCADLQIEWETFV
RGRILVDSGSIDLAVEDVRVDISIGTKYSTTRFTDEDGYFEVLVSSPDLYDIRQTMTLSF
SKTSGEVGHTFSCGGMACTEMTLQVEHLRFDYEVEVRDTTSVPFSGRVTIQGTEHQGYPD
GCPLRDVEVCLYDRIDGGKELVCATTDSQGYYTAAAVIGSSVYVIVSYGNSSHSFQRLEY
TSGAPNAPSGFYIGTDTSSGLDTRIPYYDVLDGKEWKDVDFQDTTVDTVVVDVAGGLCNR
TLGRSVLEFRYDNCPTWVHTEQTSSRTSTWTLPAQIITVRLARVVRSGEVREEITRYFSS
TLGTSRSQYADLRNAEDSEDDETTVRFEYHPQPTLSVSFTPTVAHSCSYSDDTDFIVMQQ
RTETIATVKAIEEFGAGVASCDIVEGSVTVQNLLGESPTTANQAVGVTVTQRELLQVCYS
ECELDLDLDEVVTAAGTEQSNAHATLRLLTGGPELNSEAVDPEHPYTKQFRVSMQVLPYD
PVILYKKVVVTGHQARGASGSVPFPRYKPLLVVQDPPGGLSTASYSSMFANFRFHSKTYE
AFGGFQLGVDVAPYKTEAELDLCTGAIAAYNCINLVSVKSTPYTFQTKTTNLFGGQSPDD
NFNREQVWSFTIDVTTSDEPMIAGEQSDMFLVPALNVVFLDTDVISFNTTTCSVNRSLTT
TWSLDPEANEQVMTWLSVFEIESKELPELEERLEATIASIAEAEASDDDDGDNLADLQQL
KDELELAISAWNDNLQRNRNVRNSAASGTLEKVQSLWTAGKYLSNENANPIQGKVNRRIA
FAPNDSIDNAKNLDGTDTTGEDQATLREISAIKFAGGGSLYSFSFDYSNHKSAVSSSKSK
HNFEGGGTVSFDVSSSTGGADFSVTALGLTEVETSRETEEGYAKESSAGFELGDADPLDV
FDVEVYVHPDFGTLVFHTTSGQSSCPPENNTIALENPRISILKQPAAPVLPNEPAVFELL
LTNDGPVATDFNLFNLNSENQDGLTIMVDGHPLTHPIDFEGFAVGARHVTISLLRGPSLY
SYDPVAVGWRSLCEADRHPDNGYTTDEVTTVQYVYLEAEFLQPCSPVELVGSIGETETFE
VNQAVDEQTSHPGELRIVAFNSDFASRKWTEDDRLEGVYVEYKPAASSVWLLARDIDGNT
LDVRLMENEYGYVTTYWDVSGITDGDYELRIRAQCTASINEVPDGIDEQYSSTATGVIDR
SAPQVLGYPEPADGEYSPGDEIAFEFDEDVQCAKPFWFEVQMTIDGLDEVFANDDMVMVC
EGRRITMSLVRGFAWDDVSGRSARVTLNSVQDPYGNVASQEFVLEFQFALVAAEALTTQL
TGIELPLPFEDAFFNTKSPEYQNVTARIEADIANATGIVVTRVRVASLAPTDLFDYDAGI
TVSVYLLPEDTATRRRRRRDGLPSLSPSRAAQFFNNILINGTANLGRNSLFFNVSTLGRP
EMMVLTSNRNGNSIDTTSTTSQPSTSTGETVDSGASSSKLENMTELNTNLSYAILVLVLV
VIVLEVQRIVYSFRKHTYAVKEPPMVVAHQAQASRASFELHGGRSTSSYGRPFYDDFDGE
TTTTMSHV
Download sequence
Identical sequences F2US07
XP_004987976.1.12839 PTSG_11057T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]