SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11058T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11058T0
Domain Number 1 Region: 1100-1365
Classification Level Classification E-value
Superfamily NHL repeat 2.12e-29
Family NHL repeat 0.00067
Further Details:      
 
Domain Number 2 Region: 313-371
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000121
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 3 Region: 382-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000208
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 499-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000361
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 562-631
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000403
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 6 Region: 842-913
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000153
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 621-688
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000153
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 8 Region: 426-503
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000032
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_11058T0
Sequence length 1367
Comment | PTSG_11058 | Salpingoeca rosetta NHL repeat-containing protein (1368 aa)
Sequence
MNTNVWNLGTSQRGDLYFRCDTGEGLTYMTSKYSDNKYDRRWDFSCAPIGTASSDTQSSG
GYDVRDLHSNNNYDCASGYSSYENSRTGNLDYDITGTNKIITGLYSKYTDTLFEWDRRWK
ITTCEVECDLTGDYVNSDVPRVCTTLSLSGITNGNFVADYQESFGSYCETSTAITTISTQ
FAASSTDRRWAFTCTKPTSGGQVITSQTWSTPAYGKLGTAFTVSCPSNTYITGVKSAYVS
SFQDRVYSFQCTGYENTEISAVNCNGAVAVNAAGADFDFSTSSGAYVITSLTSTFDSSTS
DREWTFTECKPQCVDGTMLNSDGYCSGDECTFESCNTGYEFSSAATTRTCDADGAWSGAD
ITCEPITCNRLTHSQITLIGSCSGNYGDVCTYYSCPSGYALRGTTFSRECTADGWTGTEP
YCELLECSELTAPTNGWRGDTCTGTLGSTCERGCNDGFVLSPTEASGGFTRTCTETTDSD
GLAVAEWTGSERTCITVDCGEIVLANGQTSGECSGNYDDTCTYDECDTGYALSSGGSTRR
TCGVTDGVAAWSGTSKQCEVVTCSSIEVQNGVTSGTCDGTVGGECSFTCDTGYWPSSSIT
TTTCVLHADGHSASWDATIATCTEVMCPTLTLEYGSVSGSCSGTVGDVCVYDSCDDGFVF
GIGGSSSRTCIQDEDTAYWDGDEKTCLETIEGDGGTNFTIACAAGQAITGLYYTSGTDTY
EILCQDAGASLSKRIYASAETLTVSGNTAQYCDFDTYAVSGVSKKGSTLVYDCSLLAGAE
LVDCTLGDTLSGSYSILASEGSVFAGIYNTGSSSPQVRVCDVRCREEDGFYSAGGTKCRQ
LSCGALTLTNGATSGTCSGAKGDTCTYESCNYGYELSASGDTSRTCSITNGRAEWSGVAK
TCQPISTTGSPTTVNACEGLSRSLNPATCRERCERNNEDSTFMATYGGCTRVCTCGCRKR
FEITQEEDDCSAHCASQGLDASFFEEHEGCRNVCLCFEASTRSTATAVTTTTEVTFTTQA
TGTVETIAGNGLVDWTGSSDPTATGLNQAECVAVDVTGATYIAIRHRVVSISRDGSTITT
IAGTKTRGSTGVGGLATAAQLDRPTCVAVDTMGNVYISEKGNHRVSVVDASTGVLSVFVG
TGEAGHRGMGGSSRAAQIHSPHGLAFDSRGTLYIADTENHVVYGVDRRSVVIDVVAGTPF
RKGYHGDGRPATTAWLNAPTGIAVRGAGDLYIADKGNNRIRYVDLDSYKIIDTLVGTGRY
GGDVDGSTTTAALETNLDHPEGVAVNAKGTMLVIADTNKHVLRSVSLDGGDSPVTVLAGT
GSRGFNGDGNEPNATNLHSPVSVAYDIGERAIVFVDQQNRRIRRVHL
Download sequence
Identical sequences PTSG_11058T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]