SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11120T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11120T0
Domain Number 1 Region: 605-762
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.18e-22
Family Growth factor receptor domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1275-1408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.12e-19
Family Growth factor receptor domain 0.00082
Further Details:      
 
Domain Number 3 Region: 2503-2606
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000431
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 2645-2747
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000734
Family SH2 domain 0.0008
Further Details:      
 
Domain Number 5 Region: 433-475
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000863
Family TNF receptor-like 0.006
Further Details:      
 
Domain Number 6 Region: 179-308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000239
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 819-861
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000203
Family TNF receptor-like 0.0051
Further Details:      
 
Domain Number 8 Region: 1040-1078
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000243
Family TNF receptor-like 0.004
Further Details:      
 
Domain Number 9 Region: 1164-1204
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000247
Family TNF receptor-like 0.0048
Further Details:      
 
Domain Number 10 Region: 1697-1735
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000051
Family TNF receptor-like 0.0038
Further Details:      
 
Domain Number 11 Region: 1120-1164
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000875
Family TNF receptor-like 0.0034
Further Details:      
 
Weak hits

Sequence:  PTSG_11120T0
Domain Number - Region: 1969-2030
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000184
Family TNF receptor-like 0.0042
Further Details:      
 
Domain Number - Region: 1080-1120
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000196
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number - Region: 523-560
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000471
Family TNF receptor-like 0.01
Further Details:      
 
Domain Number - Region: 379-432
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000807
Family TNF receptor-like 0.015
Further Details:      
 
Domain Number - Region: 757-787,826-957
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number - Region: 2083-2121
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00706
Family TNF receptor-like 0.0074
Further Details:      
 
Domain Number - Region: 1600-1641
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0123
Family TNF receptor-like 0.013
Further Details:      
 
Domain Number - Region: 1734-1778
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0149
Family TNF receptor-like 0.003
Further Details:      
 
Domain Number - Region: 992-1040
Classification Level Classification E-value
Superfamily TNF receptor-like 0.041
Family TNF receptor-like 0.0069
Further Details:      
 
Domain Number - Region: 955-984
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0432
Family TNF receptor-like 0.0071
Further Details:      
 
Domain Number - Region: 481-517
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0706
Family TNF receptor-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_11120T0
Sequence length 2845
Comment | PTSG_11120 | Salpingoeca rosetta p75 neurotrophin receptor b (2846 aa)
Sequence
MARFLALLTFASTLLVATGQPSGFHGWANNFGGYLSFTCPSNQVLDGWYGVFSNSRLNSI
TYRSFGGYENSYYGGFTKTCPNGQAIYRIQAGHSDGYRDRPHKQQRTTTARTTAAARGVD
GPTTGPATTHTTSTTTSTTSTTPSTTTTTSFTANSKYVIRGVQSDFSYTFRDRRWRFYQC
RVSCRSGWVQSGTECTCPSGSYQRGNDCVSSRKCGRGQYAASSSNNRYCYDCRPGTFQSD
SSHTDTTCSSCPAGKFQDDYGRADCETCPSSQYNPYTGRSSCRDCSSGYYRSSPSTQTRC
QPGYRCPGSCSRIACSPGTYQNSYRQVSCKSCEAGKYQTESGASSCNNCANGYYTTSAAS
APRRCQPGFACSSCNRRACNGEFYQNAAGQSDCKRASQCGAGQYVSRGPSQTTDRVCGSC
SLGRTYQDASSHTFGSCKPVRNCPAGTFVAADPTLSSDRVCGKCQEGTYSSGVNAKQCED
IGTCDAGEYAFFASSTSGVDCRACALGSTYQDETNHNRQSCKTVSPECPAGQFQAVAPTR
SNDRVCNDCHPGTFSDRPGGDECDPHTQCGAGFIETSPATPTSDRACRRCNGVTQYQDEQ
HQSSCKTVRTCSSTQYETTAPSPSNNRVCASCTTSCPSGKVLVGTCGPTTDKRCESCHPS
CATCDGTTENDCLSCADSSLTLLDGRCVNPDCGEGEYRDGATCKPCDSSCAECDGAGSNR
CISCKGDRYLDGNSCVTKCPTGYFKFTNSERDNVCRRCTSCDDGTFASTPCDGNTFTDTQ
CSPWSTCDEGEEEDTPPNSVRDRVCRKCEADKEYQDQPGKLFCKSVSVCQRGQYVSTEPT
LTTDRQCSACGTGTFTNSENAARCLPCAAGSFQDETNSPSCQECGIGMYEPEQGQTQCAE
IPPGYYGVGGTISTRTGIAECPRGYYCLGGSHDKQACPPNQYQSETGQSQCVDLTVCGDG
ELVSKEPTSISDRECSPCPDGTCDAPETFQDKENQRTCRPVSDCPVGTAELVGPTPTSDR
KCRACQVGTNYADDTGLEICKPVTNCRPGTREVAAPTASSDRVCQACGPNTYTESENEKT
CRPHTLCGAGEKEVEEPTTSSNRRCVPCDDDTFQDSNSHSVDSCTRVTTCEPGEYLATPA
TRTSDAVCKSCKLGETFSTTDNAEGCMPVSMCGLGEREKQAPTTSTDRVCEACRDGYFQD
SASHAYPTCKEWTDCSPGEYILVEGSTFADRVCDDCSGVVTYQPKANQDNCLNVTRCEEN
TQYELTPPAANRDRVCADCTDASTCNTNEYLAGTCGGNEGTENTRCAACHPTCNGCTGPA
IDECTACGPNLQLRNGRCISECPDGEYELGNGCAECHSTCADCDGPDATNCLLCDGNLNL
WVDEQGQSCIADCPPGYYAKDHRCVPCTSCGMGTWASTPCSASSDAVCSPWTECKPGQKE
SVSGNAVRDRACVSCTLGMEYQPLPDRASCFPTSVCEDPFIETIPPTLTTDRLCSCDTLT
CNKLITQLFEEMVCAEPTDEQLDVVLDVCCSGQGEDGIRDTIRQMDAYEARRSCPGCTDT
CECSAGFILVYDADSADCLPCDGVTEFSPSVGGSKCEPIEECERGQEEVSAPTRSSDRVC
RDCPAGTIDSDSDGSTGCQMCPAGHYTEAGSHGSCSSFTCRAGTHDHDSDAATPCHPCVF
GITYQDEEGQTTCKDVTECAPGFEEVQAMTLISDRVCDECPEGTYKAVSGQGVPCLPVTT
CDAGEEETAKPTPTSDRVCSQCELGATFKPVDGQAESCRPVTQCGPDEEEIREPTRQHDR
LCRKCVQDITYRPAGSDTCVPVSRCAASEYISTHATLTTDVQCTAVGKCEFGTFQSQAPT
LDSDRECTECSECPSGRYEIRACSALEDVQCAGCSACPPNTYILRACDSENDVSCQQCST
CSDEQYRSAPCTSTSDTECTTLDVCDQDQFELFPATPTTDRICRDLTQCNPSMEYERTAP
TASSNRLCHLITKCDPGEQRIRAPTSTSDAKCEPCPIGTTDHDRNPLTACQPCPYGHYVP
AGSIGSCEQFLCPAGTADLDRNASTPCTPCQAGLDFAALSGQRDCTPVTECDLGYEEVVR
PTIFTDRQCRRCIEGLFYRDSSTDFCTRVSPCEPGSFETAAPTISTDRECQMGRTCPNNT
FISRPLTPTQNRICSPWTQCLSNEYELVAPSLVNDRECQRVRSCQDTEYEVSAPTATTDR
LCATISTCPMEQFEVLPPTTTSDRVCAPAYSVSLIFDAKFNALAGTQSRREAFEAALVQS
INTTQDASQILRIDLRQGSIIATVASLNEDFTARLFNRSVSGDITVMGFTASPCEADEFL
DDSDPNPFAPVLCSLVEECRSNQFEVSPPTSTTDRECQTARICRLGEYVVSEFTATTDRV
CGTTTTTTTTTTSTNATTTPLASTGSAASLSPGILAVIALVALLVLVVAIVLVVWRNRKA
TKDRRQNEAIQQWATMNKASDEISQANTLLRQLSLRDQSVLLFDNPMFSQPGGNQRPDWY
VGQMTRAEAEDFVLKNSGNVGDFVVRESAANGNFVLTLLIEGNQFEHHKLYKDAQGRFLI
NGNRPKTDCMTLDVLIDHLSRTMDGTSALLNLQEEYGQVRHAPQAAEPEGDFYGALSQEQ
QDFYGSVVKKDRPTYMHGPLARGEAEAILAQDRTKGNFLVRESKARPGTYAISLVIDDGR
VEHHSLRHNGSEFVLNDIPLSVRCNTVSEVINHLATNEESMSCPLRLQQNNEPVPEVPGM
EGFSNPNYTREGPASSSGGYDPLTAPRGVVANPGYQDLPPKPTHLVGGAADASTVDDDED
APPVNVRTLPKPFHLLPPEKHDASA
Download sequence
Identical sequences F2US73
PTSG_11120T0 XP_004988042.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]