SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11167T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11167T0
Domain Number 1 Region: 170-261
Classification Level Classification E-value
Superfamily vWA-like 4.3e-23
Family Integrin A (or I) domain 0.008
Further Details:      
 
Domain Number 2 Region: 24-172
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.000000589
Family Hedgehog (development protein), N-terminal signaling domain 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_11167T0
Domain Number - Region: 365-404
Classification Level Classification E-value
Superfamily Cadherin-like 0.00768
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11167T0
Sequence length 531
Comment | PTSG_11167 | Salpingoeca rosetta hypothetical protein (532 aa)
Sequence
MQIATLARVAILLAVATATTSTYALLPGEWYPDGSTEAQVSGTAVDYIDLGTAQYNALID
FEEFYLNSTGTSSPVTFASSTFRLMTEYLAEKLTSLALDTPDTIVIVQGFAPRPTNPTRP
PELTDIGRGLHMRYLNNGGLTNFLSDLANRSIEAGFDFVAIPGQGSYVNVSVPNVNCGRS
AVDLLFILDGSGSIGSSNFETMRQFTATVTSFFDVSPDTTRVALMVYSSSVTEIFDFSYV
LSNTRDEIITTIRNTNYPGGHDVFVSVTSPNPGPFNFDYVIMNDEPLKTLNVRKTSSQVV
SIAVRSRLTLLGRRRAEDTISYRLRVFNDLFNGPASHTIMVTPARNQRGAPIFDAPEAIN
FPGYSFTYTLTGPGSSMFDIDASTGRITLRDPLPDGTQHVVTLTGTSGSIVGGLALMVAT
GQPTTLPPSSGNGGSGASQSTGNASETDTAVIVGAVVGGICGFLLIVGIAFIVMRNRSSG
GAGGSSQARSRPSQSVAPATTASSPPPPSSNSTSITTDGDTKYNPAFGFDA
Download sequence
Identical sequences F2USM0
PTSG_11167T0 XP_004987814.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]