SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11179T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11179T0
Domain Number 1 Region: 419-464
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000271
Family TNF receptor-like 0.0022
Further Details:      
 
Domain Number 2 Region: 463-507
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000118
Family TNF receptor-like 0.0017
Further Details:      
 
Domain Number 3 Region: 504-548
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000618
Family TNF receptor-like 0.0018
Further Details:      
 
Domain Number 4 Region: 377-421
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000383
Family TNF receptor-like 0.0036
Further Details:      
 
Domain Number 5 Region: 240-290
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000903
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number 6 Region: 295-341
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000128
Family TNF receptor-like 0.0089
Further Details:      
 
Weak hits

Sequence:  PTSG_11179T0
Domain Number - Region: 333-374
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00111
Family TNF receptor-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11179T0
Sequence length 1183
Comment | PTSG_11179 | Salpingoeca rosetta predicted protein (1183 aa)
Sequence
MAQRAGSRKGRASARASGMSTKAGSRTEAPAPSATPRPWALVSALAVIALLASFTPFAIA
QTRACDGEACRVNRNHTIEIYNLMANDFNQTEFEQALVAAANLTGASVVQVTVREADTVC
DSGTPTGFDARTDPITRSTCSQERRRRNATMPSPPPPPSTTTMTSNTTAMPATMASNSTT
VPATMPSNMTTTASNTTMPSNSTAMPATTAVNATTTTTTTTTTTMDPCTCAENQYVVEAC
NPTQNITNATCADCSTCDAGQFVATNCRGMTDTQCGNCTDGTFQSMTAHLEMSCKPCTDT
CGSGTFLASACTRTMDTQCSACPDNTFQSADSHNLTSCTTCDTCTAGEFAFLQCTPTSNI
LCNNCTGFTYQDLLMHNSSTCKDCSMCGQGQFVADACTATTNTNCSACTGATFQNMTSHY
EMECQACSMCGQGTFLAMACNRTSDAMCSACQNGTYQDSSSHLEEQCKQCGRCDPGQRLL
SPCTATSNTSCVACDSGTWQNATGHLDPTCMMCSKCGLGQKLTTNCTLTANTVCTTCEDG
TFQDTDDHTLESCTACRTCTAGEEFESSPCAASADRACDPITTCDPRYSRERYAPTPTSD
RVCLDFRKAAVTVVVQVDTLETEIDATRAAIEAAIQDGSNGPLARELRKLDDAAYNNTEV
TYLPQVSRFDVPSEGRQFVYLDLQFAASSTQFDIQKLDLLDVLDAFLLNATEDADATATF
MERSTVSTTTTNTTTNATTTTYSTTALFRVDVDAALTITTDALNAMAAAIDAANTTSLQR
TAGPTPNGEPVMFIPCEPCRSTTHPGLYQELGFCGGLCLQCTECSLDQYLTNVCEGTSDA
QCNALPTEFETAPPVNVIGVNTNHILPTAASQQQDQAMDASMRVNRSFVFTNIAPGESTW
VAVSGEPEDGAQMVTRPLAPAAQVDCAPVLDNVYATYPTAQVVLAALDASGHSRVARTNV
TVRFVAADDEDAEVTATCTMPTDGPAVCNAWTTFADAWFSSAGPRLVDVTFKYTTPRADG
EGYETSPDMACGQLTLGPTQQEVLGVSSSIAAVVTPTNSVFENDTVDVAVIARHDWAVHS
FGVSLRCGNCRIEMSEANTAAWSISSTVTTDEESGEQMLVVAGIARDLTDEPKFSEQRSF
SLFTATVHAVPAAEDSMLVLRGNIDSFLQVRNRRPIVDTRTRD
Download sequence
Identical sequences PTSG_11179T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]