SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11192T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11192T0
Domain Number 1 Region: 845-1167
Classification Level Classification E-value
Superfamily NHL repeat 1.44e-33
Family NHL repeat 0.002
Further Details:      
 
Domain Number 2 Region: 171-243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000195
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 235-304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000375
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 104-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000542
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 5 Region: 5-51
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000181
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 6 Region: 45-111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000181
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 7 Region: 538-602
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000403
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 295-361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000431
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_11192T0
Sequence length 1169
Comment | PTSG_11192 | Salpingoeca rosetta NHL repeat protein (1170 aa)
Sequence
MSSFAGDVCSYSSCNEGYVLSSTGVTRTCQDSGSWTNSAATCQRVTCGSLSLSHGTLSGS
CSGDYGETCTFSRCDDGYAPTSGSTSRTCGYNGWSGSAIRCEPVSCPSLSISNGATSGSC
NGDYGDSCTLRCNVGYALTHSDTSITRTCTQSQVDGNAAWTGSDVACTPIDCGSLSLSNG
QLAGGCSGSYGDACTYDSCNTNYELSEDGDATRVCQQDGNDGVWTGTAKTCERIKCPTLT
VANGAVSGDCDGLSVGDECTVSSCDSGYWFSDSGSRTVTCTEVNGERMWSGSLNTCEAVT
CMALSLNHGSVSGSCSGTVGDQCTYSGCDDGFLLSSEGTTTRTCTQNEDTASWSGDAKSC
FELLEGASGETFTLSCASGQGFVGVTSDAQNSAVGDRRDWGFACDDVGSNDANRVWSMHE
EINSARGSFDFTCPYDSYYISGVTTSYLDSPNDRLWGFQCSLIFGATLGNCQLSSSYSAS
TFNFDYTVPTGHVLVGVKSSYSTSSGARSFQFRTCEVQCRTGQEYFSTGGAECQRVGCGA
LTLENGAVSGSCDGNIGDQCDYEQCNGGYTLSESGSSQRECVVVNDKPQWSGQAKTCERV
TTTTAEPTTLDVCSVYKTAPNPTTCRSQCDYYDRGDATFSKSYGECSNVCTCGCRRRFKI
TKTEERCSAHCADQGLAAAFRDMHLGCRKVCLCVDADAPTTPAGGALTEPDADENALDFP
FSEYNYEETFTGAITGNNNPRRFSTAFETSATIVNMEGESMLQCLRYCDADPDCLGIFAS
VVNGMLRCQLMSDLGSGTGVSTQIVSKSLTKGTQPSAVGTTTPSIASAIQTVVGNGGTTW
DSSATLLNTGLNQPDCVTFDGEHEMLVTMVSDHRVIRVDLRTRTSSLVAGTGEMGADGVG
GAATSAQLNRPRCAIADVEGNVYITEEGNHRVSVVDVVSKKLSVFAGTGDGGHRGMGGVA
TAAQIHSPQAMAWTEEGNLLFSDEENHAVYMVNPHTTIISVVAGTPRVAGDEGDGQLAIG
ARLNMPAGIAVYDHMLYIADSGNHRVRAVDLYTQVITTVAGTGVAGFSGDGGLPTDARLD
TPRGVAVHSSGSLAIADSGNHRVREFNIGVGAAGIITTTAGNGQRGYNGDGMVATDTALN
FPTGITFSPLTDNVLFVDRRNRRVRQIWA
Download sequence
Identical sequences PTSG_11192T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]